KEGG   Ralstonia pickettii 12D: Rpic12D_0458Help
Entry
Rpic12D_0458      CDS       T00925                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00020  Citrate cycle (TCA cycle)
rpf00640  Propanoate metabolism
rpf00660  C5-Branched dibasic acid metabolism
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01120  Microbial metabolism in diverse environments
rpf01130  Biosynthesis of antibiotics
rpf01200  Carbon metabolism
Module
rpf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rpic12D_0458
   00640 Propanoate metabolism
    Rpic12D_0458
   00660 C5-Branched dibasic acid metabolism
    Rpic12D_0458
Enzymes [BR:rpf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rpic12D_0458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACS61764
UniProt: C6BCQ3
Position
1:484239..485405
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEILRKYNVPVPRGIPAFSVDEAIKAAETLGGPVWVVKAQIHAGGRGKGGGV
KVAKSIEQVKEYASSILGMTLVTHQTGPEGKLVKRLLIEEGADIKKELYVSLVVDRVSQQ
VALMASSEGGMDIEEVAESHPEKIHTLLIDPQAGLQDAQADDIARKIGVPDASIAQARQA
LQGLYKAFWETDASQAEINPLILTGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPDVKAILVNIFGGIMRCDVIAEGVIAAAKAVSLSVPLVVRMKGTNEDLGKKM
LADSGLPIIAADTMAEAAEKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaaggcaaggaaatcctgcgcaaatacaatgtgccggttccg
cgcggcattccggccttctcggtcgacgaggccatcaaggctgctgaaaccctgggcggc
ccggtgtgggtcgtgaaggcacagattcatgcgggtggccgtggcaagggcggcggcgtg
aaggttgccaagagcatcgagcaggtcaaggaatacgccagcagcatcctgggcatgacg
ctggtgacgcaccagaccggtccggaaggcaagctggtcaagcgcctgctgattgaagaa
ggcgcggacatcaagaaggaactgtacgtgtcgctggtggtggaccgtgtgtcgcaacaa
gtggcgctgatggcctcgagcgaaggcggcatggacatcgaagaagtcgccgaatcgcac
ccggaaaagatccacacgctgctgatcgatccgcaagccggtctgcaagacgctcaggct
gacgacatcgctcgcaagatcggcgtgccggatgcttcgatcgcgcaagcccgccaagct
ctgcaaggcctgtacaaggcgttctgggaaaccgacgcttcgcaagctgaaatcaacccg
ctgatcctgaccggcgacggcaaggtcatcgcactggacgccaagttcaacttcgactcg
aacgcgctgttccgtcacccggaaatcgtggcgtaccgcgatctggatgaagaagacccg
gcggaaatcgaagcctcgaagttcgacctggcttacatctcgctcgacggcaacatcggc
tgcctggtgaatggcgctggtctggccatggcgacgatggacaccatcaagctgttcggc
ggcgagccggccaacttcctcgacgtgggcggcggtgccaccaccgagaaggtgaccgaa
gccttcaagctgatgctgaagaacccggacgtgaaggccattctggtcaacatcttcggc
ggcatcatgcgttgcgacgtgatcgccgaaggcgtgatcgctgcagccaaggctgtgtcg
ctgtcggtgccgctggtggtgcgcatgaagggtaccaacgaagacctcggcaagaagatg
ctggccgactcgggtctgcccatcatcgccgcagacacgatggcagaggccgccgagaaa
gtcgtggccgcagccgccggcaagtaa

DBGET integrated database retrieval system