KEGG   Ralstonia pickettii 12D: Rpic12D_0461
Entry
Rpic12D_0461      CDS       T00925                                 

Definition
(GenBank) fimbrial protein precursor PilE (MS11 antigen)
  KO
K02650  type IV pilus assembly protein PilA
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rpic12D_0461
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_0461
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_0461
Secretion system [BR:rpf02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Rpic12D_0461
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_0461
SSDB
Motif
Pfam: Pilin N_methyl ComP_DUS Phage_holin_6_1
Other DBs
NCBI-ProteinID: ACS61767
UniProt: C6BCQ6
Position
1:487403..487906
AA seq 167 aa
MGFKHSKETTRRAGGFTLIELMIVVAIVGILAAIALPAYNNYMVKSKLTEAIATLDSARV
AVNEAYTSGGGVFPAQPPVVVQAVANNAKYVTGIQYNLGPASTVGVVVKLGNTGAASIDN
AYLGIFGQGKVDGTVAWACSTARTPGDFASGAAMTAMYPYLPLACQN
NT seq 504 nt   +upstreamnt  +downstreamnt
atgggctttaagcacagcaaggaaacaacgcgtcgagcaggcggatttacgctgatcgag
ctgatgatcgttgtggcgattgttgggattctggcagcgattgcgctgccggcttacaac
aactacatggtcaagtcgaagttgaccgaggcgatcgcgacgctggattcggcgcgcgtg
gcggttaacgaagcgtacacgtctggcggtggtgtgtttccagcgcagccaccggttgtt
gtgcaggcggtagcaaacaacgcgaaatatgtgacaggcatccagtacaaccttggcccg
gcttccaccgtgggtgtggtcgttaaactcgggaatactggggctgcctctatcgataac
gcgtatctcggcatctttgggcagggtaaggttgacggaacggtggcctgggcgtgctcg
acggcgagaaccccgggagactttgcctcaggtgccgcaatgactgccatgtatccgtat
ttacctctcgcgtgtcagaactga

DBGET integrated database retrieval system