KEGG   Ralstonia pickettii 12D: Rpic12D_0546
Entry
Rpic12D_0546      CDS       T00925                                 

Definition
(GenBank) response regulator receiver protein
  KO
K02282  pilus assembly protein CpaE
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_0546
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_0546
Secretion system [BR:rpf02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   Rpic12D_0546
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_0546
SSDB
Motif
Pfam: CbiA AAA_31 CBP_BcsQ ParA 3HCDH_RFF Response_reg
Other DBs
NCBI-ProteinID: ACS61851
UniProt: C6BDB6
Position
1:complement(578066..579259)
AA seq 397 aa
MAKIALVSADESHLQHLAGLITQAANHVVQRTRATPSQALTRPDLGQGNDLLILEASRFS
SDDLQQLRRLSSEHPETLCMLLTEAPSADLLMRAMRAGVQCVLPWPPEAQEFRDEVQRCT
SHALSSSHNDGQVVSFLSCRGGSGTTFIAANFAHVLSARHGKRVLLIDLCQQYGDAAFLL
TDQSPPATLANVCNQIDRLDAALLDACLTHVSQDFDVLAGAGDPIKSGEIKATHLERILA
LAASMYDVVVFDVGQDINPASIVVLDHSNVIYPVLHLSLPYLRAGRKLMEICHSLGYRAE
RLRLVINQYDKHMPISQNMMESAFGMPVAHILPYDPGPVRDATTQGMPVLQLAENSPIAR
ALADMARQLFPGSQHRRDGLLRKLFRHASQVPAPVRA
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggccaagatcgccctcgtatccgccgacgaatcgcacctgcagcacctggccgggttg
attacacaggccgcgaaccatgtcgtgcaacgcacgcgcgccacgccgtctcaggcactg
actcggcctgacctcgggcaaggcaatgacctgttgatcctggaagccagccgcttcagc
agcgacgacctccagcaactgcgccgcctgtccagcgagcaccccgagacactatgcatg
ctcctgaccgaagcaccgtccgcagacctgctgatgcgtgccatgcgtgccggcgtgcaa
tgcgtgctgccgtggccgcctgaagcgcaggagtttcgcgacgaagtgcagcgttgcacc
agccacgcactctccagctcgcacaatgacgggcaggtggtgtcgttcctttcgtgccga
ggcggcagtggcacgacattcatcgcagccaacttcgcccacgtgctcagcgcccgccac
ggcaagcgtgtgctgctgatcgatctctgtcagcaatacggcgacgccgcgttcctgctc
accgatcaatcgccccccgccacgctggccaatgtgtgcaatcagattgatcggctcgac
gcagccctgctcgacgcttgtctcacccacgtgtcgcaagactttgatgtgctggccggc
gccggagacccgatcaagagcggcgagatcaaggcaacgcacctcgagcgcatcctcgct
ctagccgcgtcaatgtatgacgtggtggtcttcgatgttgggcaggacatcaatccggcc
tccatcgtcgtgctcgatcacagcaacgtgatctaccccgtgctgcatctcagcctcccc
tatctgcgcgctggccgaaaactgatggagatctgccattcgttgggctatcgcgcagaa
cggctgcggctggtcatcaatcagtacgacaagcacatgcccatcagccaaaacatgatg
gagagcgcctttggcatgcctgtagcgcacatcctgccgtacgacccggggcctgtgcgt
gacgcgaccacgcaaggcatgccggtgctgcagctggccgagaacagcccgatcgcccgc
gcgctggcagacatggcgcggcaactgtttccgggctcacagcaccggcgcgacgggctg
ttgcgcaagctcttccgacacgcaagccaggtgccggcccccgttcgcgcttag

DBGET integrated database retrieval system