KEGG   Ralstonia pickettii 12D: Rpic12D_0548
Entry
Rpic12D_0548      CDS       T00925                                 

Definition
(GenBank) type II and III secretion system protein
  KO
K02280  pilus assembly protein CpaC
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_0548
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_0548
Secretion system [BR:rpf02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   Rpic12D_0548
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_0548
SSDB
Motif
Pfam: Secretin T2SS-T3SS_pil_N
Other DBs
NCBI-ProteinID: ACS61853
UniProt: C6BDB8
Position
1:complement(579660..581471)
AA seq 603 aa
MDRLVHRSAKRCIGPYLTRKAFAAAALGVLCVGMAHGQVGVESAILTNNAAAPAKPLKMA
ASGPIQLTIGSPATAEANRDSAGKGPNCTGPMRSHSEVTVPVGKSTMVQLPEPVRSRTVG
NPNVVQAMLVSPQTLYVLGLEVGSTNMIVQGRSGSCSVVDVAVGADPGGLQSTLRKLMPE
ARNVQVSAAADSLVLGGSVSDSVQAQKVVDIANAFVMRRTRGPNEGEQNATGQGGQQLHT
AGPGAPLRSPRIINMMTVEAPQQVMLEVKVAEVSKTLIDQMGAAFNANGAFGSWSFGAIA
NFLSGSSDIVNFSKANHLPLKFALDAQKGDGLVKVLAEPSLMAISGQEASFLAGGKVFIP
VAQGAAANGVATIVLQEETFGVGLRFTPTVMENGRINLKVSPEVSELSPTGVAVTAPNSN
NTSILPLITTRRASTTLQVHDGQSFAIGGLIKNNITGSLKALPGIGELPIIGSLARSTSF
QQDQTELLFVVTPRLVKPLPAQYPLPTDSFGTINRGELYLNGNMEGHVQAPASQPTAVAA
PAANPEKAAAEPAAAPGPSAQAPTPTNVPAAPAAPVTPVAPAASTAPRDTRRFVATGEQS
TGN
NT seq 1812 nt   +upstreamnt  +downstreamnt
atggaccgactcgttcatcgcagcgccaagcgctgcatcggaccgtacctgacacgcaag
gcgtttgcggcggccgcgctgggggtgctgtgcgtgggtatggcgcatggccaggtgggc
gtcgagagcgccatcctgaccaacaatgcggcagcacccgccaagccgctgaagatggcg
gccagcggcccgatccagctcacgattggcagccccgccaccgctgaagccaaccgcgac
tcggccggcaagggcccaaactgcacgggccccatgcgttcgcacagcgaggttacggtg
ccggtcggcaaatcgacgatggtgcaactgcccgagcccgtgcgaagccgtaccgtcggc
aatccgaacgtcgtgcaggcgatgctcgtctctccgcagacgctgtacgtgctggggctg
gaagtgggctccaccaacatgatcgtgcagggccgcagcgggtcgtgcagcgtggtggac
gtggccgtcggtgccgacccaggcggtctgcaatccacgctgcgcaagttgatgcccgaa
gcccggaatgtgcaggtgtcggccgccgccgatagcctggtcctcggcggctccgtcagc
gattccgtccaggcgcaaaaggtggtcgacattgccaacgcctttgtcatgcgccgcacg
cgcggccccaacgagggtgagcagaacgcgaccggccagggtggccagcagctccacacg
gccggccccggagcaccgctgcgcagcccgcgcatcatcaacatgatgacggtcgaagca
ccccagcaggtcatgctggaagtgaaggtggccgaggtgtccaagacgctgatcgaccag
atgggcgccgcattcaacgcgaacggcgcgttcggtagctggtctttcggggccatcgcc
aacttcctctcgggctcgagcgacatcgtcaacttcagcaaggccaaccacttgccgctc
aagttcgcgctcgatgcgcaaaagggcgatggcttggtgaaggtgctggccgaaccgagc
ctgatggccatcagcgggcaagaggccagcttcctggcgggcggtaaggtgttcatcccg
gtggcgcagggcgctgccgccaacggcgtggccacgatcgttctgcaggaagaaaccttc
ggtgtgggcctgcgcttcacccccacggtcatggagaacggacgcatcaacctgaaggtg
tcgcccgaggtgtcggaactgtcgcccacaggtgtggctgtcaccgcgcccaacagcaac
aacacgtcgatcctgccgctcatcaccacacgccgcgcgtcgaccacgctacaggtgcat
gacggccagagcttcgccattggcggcctcatcaagaacaacatcacgggcagcctgaaa
gcactcccgggcattggcgagctgccgatcatcggttcattggcacgcagcaccagcttc
cagcaagaccagaccgagctgttgttcgtggtcacaccgcggctggtcaagccgctgccg
gctcagtatccgcttccgaccgacagcttcggaacgatcaaccgcggcgagctgtacctc
aacggcaacatggagggccacgtccaggcacccgccagccagccaaccgcagttgcagcc
cccgccgccaacccggaaaaggccgccgcagagcccgctgcagcgccaggaccgtccgcc
caagctccgacgcctaccaacgtacctgcggcgccggcggctcctgttactccggtcgcc
cccgccgccagtaccgcgccccgcgatacacggcgctttgtagcgactggcgagcaatcc
accggcaactga

DBGET integrated database retrieval system