KEGG   Ralstonia pickettii 12D: Rpic12D_0551
Entry
Rpic12D_0551      CDS       T00925                                 

Definition
(GenBank) Flp/Fap pilin component
  KO
K02651  pilus assembly protein Flp/PilA
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_0551
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_0551
Secretion system [BR:rpf02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   Rpic12D_0551
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_0551
SSDB
Motif
Pfam: Flp_Fap DUF4244 Flp1_like
Other DBs
NCBI-ProteinID: ACS61856
UniProt: C6BDC1
Position
1:complement(583467..583643)
AA seq 58 aa
MKAMIKRFVREEDGAAGVEYALLLAFVALVMVASGPTVKAAVGSIWSTIATQLSTAAA
NT seq 177 nt   +upstreamnt  +downstreamnt
atgaaagccatgatcaagcgtttcgtgcgcgaagaagacggtgcagccggcgtggaatac
gcactgctgctggcatttgtggcactggtgatggtggcctctggccccaccgtcaaggct
gccgtcggcagcatctggagcaccatcgcgacccagctgtcgacggccgccgcctga

DBGET integrated database retrieval system