KEGG   Ralstonia pickettii 12D: Rpic12D_0655
Entry
Rpic12D_0655      CDS       T00925                                 

Definition
(GenBank) hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Other DBs
NCBI-ProteinID: ACS61956
UniProt: C6BDM1
Position
1:690143..690394
AA seq 83 aa
MSLSFASAPMSAEQARAESIGYQALAFVGKRLPLQVLCSAAGHYIGTADADGPVSRESVS
YFRSLNAADHALKTGRWQQRLNP
NT seq 252 nt   +upstreamnt  +downstreamnt
atgtccctttcgttcgcatcggcgcccatgagcgctgaacaggcccgcgccgaatccatc
ggctaccaggccctggccttcgtcggcaagcgcctgcccctgcaggtgctttgcagcgca
gccggccactacatcggcaccgccgatgcggacggcccggtctcgcgcgagtcggtcagc
tacttccgctcactcaacgccgccgaccacgccctgaaaacgggccgctggcagcagcgc
cttaacccgtga

DBGET integrated database retrieval system