KEGG   Ralstonia pickettii 12D: Rpic12D_0656
Entry
Rpic12D_0656      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Other DBs
NCBI-ProteinID: ACS61957
UniProt: C6BDM2
Position
1:690420..690812
AA seq 130 aa
MNRALPQEVLDQIELEHQHFAAAPQAFFEAWKRGVNIAGAEWFGDGTREGLQRAATKWDL
RPKLLMLNDALGVLSSGQRMFLSAMVSFYNAREGGAMLKRCGFEGLSDLGGLDLERRKVI
ADLTLNYNGW
NT seq 393 nt   +upstreamnt  +downstreamnt
atgaatcgtgccctgcctcaagaggtacttgatcagatcgagctggaacaccagcacttc
gccgccgcgccccaagccttcttcgaggcatggaagcgcggcgtcaacattgccggagcc
gaatggttcggcgacggcacccgcgaaggcctgcagcgtgccgccaccaagtgggatctg
cggccgaagctgctgatgctcaacgatgccctcggcgtcctgagcagcggccagcggatg
ttcctgtccgcgatggtgagcttctacaacgcccgcgaaggcggcgcgatgctcaagcgt
tgcggcttcgagggtctgtccgacctgggcggcctcgatctcgaacggcgcaaggtcatc
gccgacctgacgctgaactacaacggctggtga

DBGET integrated database retrieval system