KEGG   Ralstonia pickettii 12D: Rpic12D_0657
Entry
Rpic12D_0657      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: PilJ
Other DBs
NCBI-ProteinID: ACS61958
UniProt: C6BDM3
Position
1:690990..691709
AA seq 239 aa
MANNYQDATGVLILDRVTPVISALFGAFHLDGSYPGNGKAYIARLTEINDPQWSDVLDGL
MALAARLDLPAPDDAEGEDGEDRDTELSMPALIDLIAPHFGADQNQDLANLIEHHPFEGS
ADLDALFLIATCFDDGHHLVAIQLEGCWRCSRSRLFEFGGHGCFISRELTVSSESTHALQ
LGAELRTAILAGDLAAASNRIANETLALLAAITDDQVRARLRRSVADRLLTDPSLTAAD
NT seq 720 nt   +upstreamnt  +downstreamnt
atggccaacaactaccaagacgccaccggcgttctcattctcgaccgggtgacgccggtc
atctccgcgctgttcggcgcctttcacctcgatgggagctatcccggcaacgggaaggct
tacatcgctcgcctcaccgagatcaacgatccgcaatggagcgacgtgctcgacggtttg
atggcgctggccgctcggcttgacctgcccgcaccggacgacgccgaaggcgaggatggt
gaagaccgtgacaccgaactgtcgatgccggcccttatcgacctgatcgccccgcacttc
ggcgccgaccagaaccaagacctcgccaatctcatcgagcaccacccttttgagggcagt
gcagacctcgacgcgctgttcctgatcgccacgtgcttcgacgacggccatcacctggtc
gccatccaactcgaaggatgctggcgttgcagccgttcacggctgttcgagttcggcggg
catggttgcttcatcagccgcgagctgacggtatcgagcgaatccacgcatgcactgcaa
ctcggcgcggaactgcgcacggccatcctggccggcgatcttgcggcggcgtccaaccga
atcgccaacgagacgctggcgctgctggcggccatcacggacgaccaggttcgcgcacgc
ctgcgcaggtccgtcgccgaccgactgctcaccgacccgtccttaaccgccgccgactga

DBGET integrated database retrieval system