KEGG   Ralstonia pickettii 12D: Rpic12D_0658
Entry
Rpic12D_0658      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Other DBs
NCBI-ProteinID: ACS61959
UniProt: C6BDM4
Position
1:691789..692505
AA seq 238 aa
MSYSNNNPFIRGYDGLSVERLLAISYDDDCPLTYLPLHPSQSNLPDSQIERRTCIFSDDF
VLITEDQAVPDELQAQCRSHGLARNVVYAVMAEEAGKPLHVGDTYSEEAAREVVQRLRFE
TGYYSRCWEISSAHLDAEAHRFLAELADIATPTLFLFVAFRIPYSQAIGLKLIATPWTDE
NLRAVEGITAKRLMQEHRKKGMPESLVHVLHLAALADVRMLAFDADAQVLDGLPIYDD
NT seq 717 nt   +upstreamnt  +downstreamnt
atgtcctactcgaacaacaatccctttatccgcggctacgatggcctgtcggtcgagcgg
ctgctcgccatctcctacgatgacgactgcccgttgacctacctgccgctgcatccctcg
cagtcgaatctgccggacagccagatcgaacggcgaacctgcatcttctctgacgacttc
gtgctgatcaccgaggaccaggcggtccccgacgaactgcaggcgcaatgccgcagccac
ggcctcgcccggaacgtggtctacgccgtcatggccgaagaggcgggcaagccgctgcac
gtgggcgatacctactccgaggaagcggcccgcgaagtcgtgcagcgcctgcgcttcgag
accggctactacagccggtgctgggaaatcagcagcgcgcacctcgatgctgaggcgcat
cgcttcctcgccgagctggcggacatcgccacgccgacgctgttcctgttcgtcgccttc
cgcatcccgtacagccaggccattgggttgaagctgatcgccacgccctggaccgatgag
aacctgcgcgccgtcgaaggcatcacggccaagcggctgatgcaggagcaccgcaagaag
ggcatgccggaatccctcgtgcacgtgctgcacctggccgcgctcgccgacgtgcgcatg
ctggccttcgatgccgatgcgcaggtgctggacggactgccgatctacgacgactga

DBGET integrated database retrieval system