KEGG   Ralstonia pickettii 12D: Rpic12D_0659
Entry
Rpic12D_0659      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Other DBs
NCBI-ProteinID: ACS61960
UniProt: C6BDM5
Position
1:692798..693595
AA seq 265 aa
MDTQAIRAQMPTLVRGHVPSNVRSFKFNIFDGQPKVSTLGFHIDPKPFEGKVIATTDEAI
VVKTGRAEFAVLDKKLVTEVPDEGAKVQVEPYVRRRFDGLRADTPEESTEFTAGGQPYTV
KRLILGSAPAKLPIPAPQCPELQELVHQLEQLPAPDGFRRVTHLLVDAGARDFMVVDPSP
SNIIATPPAIGFTVASAKFQGQVTVLYERGLDLYAVELRRDGELVERVDEVFFDTLGQTL
ERLIDDGTWRLIRVQRLSGHKPVSH
NT seq 798 nt   +upstreamnt  +downstreamnt
atggatacccaagccatccgcgcacagatgccgacgctggttcgcggccacgtgccttcc
aacgtccgcagcttcaagttcaacatcttcgacggccagcccaaggtttcgacgctgggc
ttccacatcgatcccaaacccttcgagggcaaggtcatcgccaccaccgacgaggccatc
gtcgtcaagacggggcgggccgagttcgcggtgctcgacaagaagctcgtcaccgaggtg
cccgacgaaggcgccaaggtgcaggtcgagccctatgtgcggcgccgttttgacggcctg
cgcgcggacacgcccgaggaaagcaccgagttcaccgctggcggccagccttacacggtg
aagcggctcatcctgggttccgcgccggccaagctgccgatccccgcgccgcagtgcccg
gagttgcaggaactggtccatcaactggagcagttgcccgcacccgatggttttcggcgc
gtcacccacctgctggtggatgccggagcgcgggacttcatggtggtcgatccgagcccc
agcaacatcatcgccacgccgccggccatcggcttcacggtcgcttcggcgaagttccag
gggcaggtcacggtgctgtacgagcgcggcctcgacctctacgcggtggaactgcgccgc
gacggcgagctggtcgaacgggtcgatgaagtgttcttcgacacgctgggccagacgctg
gagcggctgatcgacgacggcacctggcgcctcatccgcgtgcagcgcctgtcgggccac
aagccggtttcgcactga

DBGET integrated database retrieval system