KEGG   Ralstonia pickettii 12D: Rpic12D_0660
Entry
Rpic12D_0660      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF3085
Other DBs
NCBI-ProteinID: ACS61961
UniProt: C6BDM6
Position
1:693672..694037
AA seq 121 aa
MTIRFKGADLRPVLTEALANQCRVILVKDQGVYFMAERGERRPDGRRKTIAYAVGCNPNA
DPFDDWWELARAEFGGDDFGEFFDLHDGVFARLLHGEDDLEVSATATHLSLQVVPQAQSG
H
NT seq 366 nt   +upstreamnt  +downstreamnt
atgactattcgattcaagggcgccgatctgcggcccgtgctgaccgaggcgctggccaac
cagtgccgcgtcatcctggtcaaggaccagggcgtctatttcatggccgagcgcggcgag
cgtcggcccgatgggcgacgcaagaccatcgcctacgccgttggctgcaacccgaacgcc
gatccgttcgacgactggtgggaactggcgcgcgccgagttcggcggcgacgacttcggc
gagttcttcgatttgcacgacggcgtgttcgcgcggcttctgcacggcgaggacgacctc
gaagtctcggccaccgctacacacctgtcgttgcaggtggtgccgcaggcacagtccggc
cactga

DBGET integrated database retrieval system