KEGG   Ralstonia pickettii 12D: Rpic12D_0661
Entry
Rpic12D_0661      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: PAPS_reduct Prim-Pol
Other DBs
NCBI-ProteinID: ACS61962
UniProt: C6BDM7
Position
1:694175..695017
AA seq 280 aa
MRDPFRIESPACISFSGGRTSAYMLWRVLQANGGLPADTVVCFANTGKEVEATLRFVRGC
AKHWQVPIHWLEYRPTEPGFAVVDFDTASREGEPFEALIRKRQYLPNPVARGCTSALKIR
TMHRFLRRQGWTDWDQFIGIRADEQRRVAKIRARGHSTESSHETMCMPLADAGVTVHDVS
AFWQAQPFDLELLTVNGRTLEGNCDLCFLKPRGQRLALIKARPEAAVWWIRMESLNLASR
PSGARFRNDGPSYADLARFAADQGDLFDAAEEAIACFCGD
NT seq 843 nt   +upstreamnt  +downstreamnt
atgcgcgacccgttccgaatcgaatcccccgcctgcatcagtttcagcggcgggcgcacc
agcgcgtacatgctctggcgcgtgctgcaggccaatggcggcttgccggccgacacggtg
gtctgcttcgccaacaccggcaaggaggtcgaagccacgctgcgctttgtgcgcggctgc
gccaagcattggcaggtgcctatccactggcttgaataccggccgacagaaccgggcttc
gcggtggtggacttcgatactgccagccgcgagggggaacctttcgaggcgctgatccgc
aagcggcagtacctgccgaatcccgtggctcgtggctgcaccagtgccctgaagatcagg
acgatgcaccgcttcctgcggcggcagggctggaccgattgggaccagttcatcggcatc
cgcgcggacgaacagcggcgcgtcgccaagatcagggcgcgcggccactccaccgaatcc
agccacgagacgatgtgcatgccgctggccgacgccggcgtgaccgtgcacgacgtgtct
gccttctggcaggcgcagcccttcgacctggagctgctgaccgtcaacggccgcacgctc
gaaggcaactgcgacctgtgtttcctgaagccccgcggccagcgcctggcgctcatcaag
gccaggccggaggccgcggtgtggtggatacgcatggagtcgctgaacctcgccagccgc
ccgagcggcgcgcgcttccgcaacgatggcccgagctacgccgacctggcgcgcttcgcg
gccgaccaaggagacctgttcgatgccgccgaagaggctatcgcctgcttctgcggcgat
tga

DBGET integrated database retrieval system