KEGG   Ralstonia pickettii 12D: Rpic12D_0662
Entry
Rpic12D_0662      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF3577
Other DBs
NCBI-ProteinID: ACS61963
UniProt: C6BE03
Position
1:695336..695890
AA seq 184 aa
MTTSTEKSFFDLHITGLGYLNRIREVKPKKGDAFLACDIAALNGPSDDVAYVRFDTRVSG
SEAQHLVRRCIQAVDAEKKVMIGFRLGDLWTDTFTYSKGKRAGEQGVSLKARLLFVSWIK
VDGKLVYKAEPKPTDADDRDVRNTDVPATSTAPQAAAPEPSRPAAEAADEATADAPALEV
AESF
NT seq 555 nt   +upstreamnt  +downstreamnt
atgaccacttccaccgaaaagtccttcttcgacctgcacatcaccggcctcgggtatctc
aatcgcatccgcgaagtgaagcccaagaaaggcgatgcgttcctggcctgcgacatcgca
gcgctcaacggccccagcgatgacgttgcctacgtgcgtttcgacacgcgcgtctcgggc
tccgaagcgcagcacctggtgcgccgctgcatccaagcggtcgatgccgagaagaaggtg
atgatcggcttccgcctgggcgacctgtggaccgacaccttcacctactccaagggcaag
cgtgccggcgagcagggggtgagcctcaaggcccgcctgctgttcgtcagttggatcaag
gtcgatggcaagctcgtctacaaggccgagcccaagccgaccgatgccgacgaccgcgac
gtgcgcaacacagatgtccccgcgacgtccaccgcgccgcaagccgctgcgcccgagcct
tccaggcccgccgccgaagctgccgatgaagccactgccgatgctcccgcattggaagtt
gccgagtcgttctga

DBGET integrated database retrieval system