KEGG   Ralstonia pickettii 12D: Rpic12D_0666
Entry
Rpic12D_0666      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Other DBs
NCBI-ProteinID: ACS61967
UniProt: C6BE07
Position
1:698584..699702
AA seq 372 aa
MALMFPRLARNFVKNGYFPTDEPTLERALAALAPAESSNGPLCIIDPCAGEGVAIAEAAH
ALGREQVQAFAVEYEAERARHARQLVDRCIHGDLMDTLISRQSFGLLWLNPPYGDLTKDA
NGNVGYQGQGRARLEKLFYQKALPLLQYGGVLIYIVPHYVLDAELVGWLTRHFADLRIYR
AVEAQFKQVVIFGRRVRQRDQASDSVKAMRALLLQIGQGDAEAEELPVEWPFLPYTVPAS
PAEPEHFYRVTMEPEQFAEEVGRLQGLWPTLDTHLGAAQQSLRPPARALSHWHLALALAA
GAISGVVKSKTGRVLVVKGDTHKEKTLQTEYTERDDGSVAETRILTDKFVPVIRAWDMTP
GSPTCGEVLTIR
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggccctcatgttcccgcggctcgcccgcaacttcgtcaagaacgggtacttccccacg
gatgaacccacgctcgaaagagcactcgccgcgctggcacccgccgaatcctcgaacggg
ccactgtgcatcatcgatccctgcgccggcgaaggcgtggcgatcgccgaagccgcgcac
gccctcgggcgcgagcaggtccaggcctttgccgttgagtacgaggccgagcgtgcacgc
catgcccggcaactggtcgatcgctgcatccacggcgacctgatggacacgctgatcagc
cgacagagtttcggcctgctgtggctcaacccgccgtatggcgacctgaccaaggacgcc
aacggcaacgtcggctaccagggccagggccgcgccaggctggaaaagctgttctatcag
aaggcgctgccgctgctgcaatacggcggcgtgctgatctacatcgtgccgcactacgtg
ctcgatgccgagctggtcggatggctgacccggcacttcgccgatctgcgcatctaccgc
gcggtggaagcgcagttcaagcaggtggtgatcttcggccgccgtgttcgtcagcgcgac
caggcatcggattcggtcaaggccatgcgcgcgctgctgctgcagatcgggcaaggcgac
gccgaagcggaggagctgccggtcgaatggccgttcctgccgtacacggtgcctgccagc
ccggccgagccggagcacttctaccgcgtgacgatggagcccgagcagttcgccgaggaa
gtcggccggttgcaagggctctggccgacgctcgacacgcacctgggcgccgcgcagcag
tcgctgcggcctccggcgcgggccttgtcgcactggcatctcgccttggcgctcgctgct
ggcgcgatctccggcgtggtgaagtccaagacgggccgcgtgctcgtcgtcaagggcgac
acccacaaggagaagacactgcagacggaatacaccgaacgcgacgacggctccgtggcc
gagacgcgcatcctgaccgacaagttcgtgccggtcatccgtgcctgggacatgacacca
ggctcgccgacctgcggcgaggtgttgaccatccgctga

DBGET integrated database retrieval system