KEGG   Ralstonia pickettii 12D: Rpic12D_0668
Entry
Rpic12D_0668      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Other DBs
NCBI-ProteinID: ACS61969
UniProt: C6BE09
Position
1:702265..702861
AA seq 198 aa
MPSLTCVAHRLVVPALLTGCVLITGCAATGAANAPTATAVPPESVLSARVIYPEPEPTLI
PVARYGRYTLVELVPEPPQRDLTRQVIEVSIPPTFDANVGDALRHVLLRTGYRLCDTTEA
AALYALPLPAAHLRLGPLPLRDALLALAGPAWELSVDDASRAVCFTRVTAARSAGRVSAV
PAPGMTEAEPAQPQEAQP
NT seq 597 nt   +upstreamnt  +downstreamnt
atgccatcactcacctgcgtcgcccatcgcctagttgtgcccgccttgctcaccggctgc
gtgctcatcaccggctgcgccgccacgggcgcggcgaatgccccgacggccactgccgtg
ccgcccgagtcggtcttgtcggccagggtcatctacccggaacccgagccgaccctgatc
ccggtcgcccgctacgggcgctacacgctggtcgagctggtgccggaaccgccgcagcgc
gacctgacgcgacaggtgatcgaggtttcgattccgccgaccttcgatgcgaacgtcggc
gatgccctgcggcacgtgctgctgcgcaccggctaccggctctgcgacacgacggaagcc
gcggcgctgtacgcgctgccgctgccggcggcgcatctgcggctcgggccgctgccgctg
cgcgacgccttgctggcactcgccggcccggcctgggaactgtccgtcgatgacgcttcg
cgcgcggtgtgcttcacgcgcgtgacggcagcgcgctccgctggccgcgtttcagccgtc
cccgcacccggcatgacggaagccgaacccgcgcagccccaggaggcccagccatga

DBGET integrated database retrieval system