KEGG   Ralstonia pickettii 12D: Rpic12D_0669
Entry
Rpic12D_0669      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: T2SSB ABC_tran_CTD DUF3094 DUF4407 Cytochrom_B562
Other DBs
NCBI-ProteinID: ACS61970
UniProt: C6BE10
Position
1:702858..703502
AA seq 214 aa
MNIPQLPAEGADRARWLKIAAAAWLLLVSVLAVVNSVGLSRLSEQSQASAQDAHVQALNT
RVAELEQQSAASKSQPKPVAQPDFEAARKALDERLSQVEQAQAADSRAGDLQALQARVGD
IEARLKKAAAPAATPRRTAEAVKPKAPEPPFSVAGLELRGGERFLSIAAPGVAAVRELRL
LREGDAIGAWQLQAIEAHAAVFRVDGQTQRIALP
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaacatcccccaacttcccgccgaaggcgccgaccgcgcgcgctggctgaagatcgcc
gcggccgcctggctgctgctcgtgagcgtgctggccgtggtcaacagcgtgggactgtcg
cgcctgagcgagcaaagccaggccagtgcccaggatgcccacgtgcaggcactcaacacg
cgcgtcgccgaactcgaacagcagtccgctgcctcgaagagccagcccaagcccgtcgcc
caaccggacttcgaggccgcccgcaaggcgctcgacgaacggctgtcgcaagtcgagcag
gcccaagccgcggacagccgtgccggcgacctgcaggcgctgcaggcccgcgtgggcgac
atcgaggcccgcctgaagaaagccgctgcgcctgccgcgacgccccggcgcaccgccgag
gcggtcaagcccaaggcgccggagccgccgttcagcgtggcaggcctggaactgcgcggc
ggcgagcgcttcctgtcgatcgcggcgccgggtgtggccgcagtgcgcgaattgcgactg
ctgcgcgaaggcgatgccatcggtgcctggcaattgcaggccatcgaggcgcacgccgcc
gtgttccgcgtggacggccagacgcagcgcatcgcgctgccgtag

DBGET integrated database retrieval system