KEGG   Ralstonia pickettii 12D: Rpic12D_0670
Entry
Rpic12D_0670      CDS       T00925                                 

Definition
(GenBank) putative secreted protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: Glutaredoxin
Other DBs
NCBI-ProteinID: ACS61971
UniProt: C6BE11
Position
1:703512..704234
AA seq 240 aa
MKPAAIGLAAILAVVAGAASAQSAPIASSRTVPAQVQNSADAALDERLARDWGLRPEEWA
RYRQLMQGPLGVYSPNLDPLTALGIEARSDEERNRYAELQVQAESKRVGKTLAYQRAYDA
AWKRLYPGQQRVDMPGAKAAGAGNRGSGRLAVFVKAECPPCEQRARQLQAAGTAFDLYMV
GSRQDDARIRQWATQAGIDPGRVRARTITLNHDAGRWLSLGLPGDLPAVVREVNGQWQRQ
NT seq 723 nt   +upstreamnt  +downstreamnt
atgaagccagccgcgatcggtcttgccgccatcctcgccgtcgtcgcgggtgctgcctcg
gcacagtccgcgccgattgcgtcctcgcgcacggttcccgcccaggttcagaacagcgcc
gacgccgcgctggacgagcgcttggcacgcgattggggtctgcggccggaggaatgggcg
cgctaccggcaactgatgcaggggccgctgggcgtctattccccgaacctcgatccgctc
acggccctgggcatcgaagcgcgcagcgacgaggaacgaaaccgctacgcggagctgcag
gtgcaggcggaatcgaagcgcgtgggcaagacgctggcctaccagcgggcttacgacgcc
gcctggaagcggctctatccgggccagcagcgcgtggacatgccgggtgcgaaggcggcg
ggcgccggaaatcggggttcgggccggctggcggtattcgtgaaggccgagtgcccgccg
tgcgagcagcgcgcgcgccagttgcaggcggccggcaccgccttcgatctctacatggtc
ggcagccgccaggacgacgcccgcatccgccagtgggcgacccaggccggcatcgacccc
ggccgcgtgcgggcgcgcacgatcacgctcaatcacgacgccgggcgctggctgtcactc
ggcctgcccggcgatctgcccgccgtggtgcgcgaggtcaacggccaatggcagcggcaa
tag

DBGET integrated database retrieval system