KEGG   Ralstonia pickettii 12D: Rpic12D_0671
Entry
Rpic12D_0671      CDS       T00925                                 

Definition
(GenBank) Lytic transglycosylase catalytic
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: SLT Glucosaminidase Baseplate_J
Other DBs
NCBI-ProteinID: ACS61972
UniProt: C6BE12
Position
1:704219..704803
AA seq 194 aa
MAAAIALRAGSVALALGLCACASFALAQEVPPPAYQLAAQQAGVPSPVLYAVALQESGAR
LRGRLIPWPWTLNVAGRAERYATRAEACAGIRRALARTLANRIDAGLGQVNLGYHAQRYD
HPCDLLDPYRNLAIAAEILQEQHTPGEDWLVAIGRYHRPAGGAPAARYRRSVHQHLTRVL
GPGASIPSARSPMP
NT seq 585 nt   +upstreamnt  +downstreamnt
atggcagcggcaatagcgctccgtgccggcagtgtcgcactggccctcgggctctgcgcc
tgcgcgagcttcgccctggcccaggaggtgccgcctcccgcctaccagctcgccgcgcag
caggcgggcgtgccgtcgccggtgctgtatgcggtcgcgctgcaggagagcggtgcccgg
ttgcgcggccgcctgatcccctggccgtggacgctcaacgtcgccgggcgggccgaacgc
tacgccacacgcgccgaggcctgcgcaggcatacgccgggcgctggcccggacgctggcc
aaccgcatcgacgccggcctcggccaggtcaacctcggctaccacgcgcagcgctacgac
cacccctgcgacctgctcgacccgtaccgcaacctcgccatcgccgcggaaatcctgcag
gaacagcacacgccgggcgaggactggctggtcgccatcggccgctaccaccgtcccgcg
ggtggcgcgcccgccgcccgttaccgccgcagcgtccaccagcacctgacccgcgtgcta
gggccgggcgcctccattccctcagcccggagccccatgccatga

DBGET integrated database retrieval system