KEGG   Ralstonia pickettii 12D: Rpic12D_0672
Entry
Rpic12D_0672      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF2859 DUF2384 Oxidored_nitro
Other DBs
NCBI-ProteinID: ACS61973
UniProt: C6BE13
Position
1:704800..705354
AA seq 184 aa
MNRILLAAMAALLATTADAQNRSAANKAVSPPLIVVEDKGGASALPYYRALNPQDAQPGQ
PTMPQPAPRIGGPADAEAAMLPVRSARLSPGDEPRRVIRAPGLTPLFLVGDDDRSRAWLK
QRRVELQAQRAVGLVVNVATPEALAALRRLAPGLVLSPASGDDLAHRLGIKHYPVLITAT
GIEP
NT seq 555 nt   +upstreamnt  +downstreamnt
atgaatcgcatcctccttgccgcgatggcggcactgctggccaccaccgccgacgctcag
aaccgcagcgccgcaaacaaggccgtctccccgccgctgatcgtggtcgaggacaagggc
ggcgcctccgcgctgccgtactaccgggccttgaacccgcaggatgcgcagccaggtcaa
ccgacgatgccgcagccggcgccgcgcatcggtggccctgcggatgccgaggcggccatg
ctgccggtgcgctcggcgcggctgtcgcccggcgacgaaccgcgtcgcgtgatccgcgcg
ccgggcctgacgccgttgttcctggtcggcgacgacgaccgctcgcgcgcctggctcaag
cagcggcgcgtggagctgcaggcgcagcgcgccgtgggcctggtggtcaatgtcgcgaca
cccgaggcactggccgcgctgcgccgcctcgcgccgggtctggtgctgtccccggcctcg
ggcgacgacctggcgcaccgcctgggcatcaagcactacccggtgctgatcaccgccacc
ggcatcgagccctaa

DBGET integrated database retrieval system