KEGG   Ralstonia pickettii 12D: Rpic12D_0674
Entry
Rpic12D_0674      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: ACS61975
UniProt: C6BE15
Position
1:707539..708288
AA seq 249 aa
MSDPAVAVQRQQVRQQGLIASLVTLPFRLFGVLCGSLLLCIVIECIGMHFLWPEQGWRHA
QGMLNYELSQVSEHFTRSVLVQEPGRSARQLVEWAYQGLFVKTGLLDWIRDAASQSRAGA
RSQVQDFRYYLGQVYVHVESYLIASAYTVLVFLVRLLVLILILPLFLMAAFVGLVDGLVR
RDVRGFGAGRESGFVYHRARASLMPLAVLPWVTYLALPVSVHPLLILLPSAALLGVAVAI
SAATFKKYL
NT seq 750 nt   +upstreamnt  +downstreamnt
atgagcgaccccgccgtcgccgtccagcgccagcaggtccgccagcagggcctgatcgcc
agcctggtcacgctgccgttccggctgttcggcgtgctgtgcggctcactgctgctgtgc
atcgtgatcgagtgcatcggcatgcacttcctttggcccgaacagggctggcgccacgcg
cagggcatgctgaactacgagctgtcacaggtctcggagcatttcacgcgcagcgtgctg
gtgcaggaaccggggcgtagtgcacggcagctcgtcgagtgggcctaccaagggctgttc
gtgaagacggggctgctggactggatacgcgatgccgcctcgcaatcccgtgccggcgcc
cgcagccaggtgcaggacttccgctactacctcggacaggtctacgtgcacgtggagagc
tacctgatcgcctcggcctacaccgtgctggtgttcctcgtgcggctgctggtgctgatc
ctgatcctgccgctgttcctgatggctgctttcgtcggcctggtcgatgggctggtgcgc
agggacgtgcgcggcttcggcgccgggcgcgaatcgggcttcgtctaccaccgggccagg
gccagcctgatgccgctggcggtgctgccctgggtcacgtacctcgcgctgccggtcagc
gtgcatccgctgctgatcctgctgcccagcgcggcgctgctgggcgttgccgtggccatc
tccgcggccaccttcaagaagtacctgtag

DBGET integrated database retrieval system