KEGG   Ralstonia pickettii 12D: Rpic12D_0675
Entry
Rpic12D_0675      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: Plasmid_RAQPRD
Other DBs
NCBI-ProteinID: ACS61976
UniProt: C6BE16
Position
1:708403..708789
AA seq 128 aa
METSRSPAHVRRHAIAALLAALLLAAAGLQPAVAADAADNAAEREMLAAVTRQLELLDRL
AERGATTAPQERSRYHFDYARLRADLQRMRAGVRDYLVPQRAQPRDPVPLAGDYTRSGAA
SDKEAPSP
NT seq 387 nt   +upstreamnt  +downstreamnt
atggaaacctcccgcagtcctgcgcatgtccggcgccacgccatcgccgcgctattggcc
gcgctcctgctcgccgctgcggggcttcagccggccgtcgccgccgatgcagccgacaac
gccgcagagcgcgagatgctcgccgcggtgacgcgccagctcgaactgctggaccgcctc
gccgaacgcggagccaccaccgcaccgcaggagcggtcccgctaccacttcgactacgcc
cggctgcgcgccgacctgcagcgcatgcgcgcaggcgtgcgggactacctcgttccccag
cgcgcccagccgcgcgatcccgtgccgctggccggcgactacacgcgcagcggtgcggcc
agcgacaaggaggcgccgtcgccatga

DBGET integrated database retrieval system