KEGG   Ralstonia pickettii 12D: Rpic12D_0676
Entry
Rpic12D_0676      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF3262
Other DBs
NCBI-ProteinID: ACS61977
UniProt: C6BE17
Position
1:708786..709025
AA seq 79 aa
MTPSADQVAAFQANGGFAPAAVSTVVLGFVFAVLLLWGVWAMRTAYVGWAEHHLTQRQFL
GVIVRFVAMYLVLGFFLLS
NT seq 240 nt   +upstreamnt  +downstreamnt
atgacgccttccgccgatcaggtcgccgccttccaggccaacggcgggttcgcgcccgcg
gccgtctccaccgtcgtgctcggtttcgtcttcgccgtcctgctgctgtggggcgtgtgg
gcgatgcgcaccgcctatgtcggctgggccgagcaccacctgacccaacgccagttcctc
ggcgtcatcgtgcgcttcgtcgcgatgtacctggtgctgggcttcttcctcctgtcctga

DBGET integrated database retrieval system