KEGG   Ralstonia pickettii 12D: Rpic12D_0677
Entry
Rpic12D_0677      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF2976
Other DBs
NCBI-ProteinID: ACS61978
UniProt: C6BE18
Position
1:709049..709414
AA seq 121 aa
MNASLIPRRPSARIAAMLASLGLAATPLVSLAALPTLEDPSRGTGSGIMQTLQNYGYDIV
LLIALLVVASMFVGVCYHAYTRYAEIHTGRATWGQFGLTVAVGAILLVVGVWLLTKATGV
L
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaacgcttcgctgattcctcgtcgcccctctgcgcgcatcgcagccatgcttgcctcg
ctgggcctcgctgccacgccgctcgtctcgctggcggccctgcccaccttggaagacccg
tcgcgcggcaccggcagcggcatcatgcagacgctgcagaactacggctacgacatcgtg
ttgctgatcgcgctgctcgtggtcgcctcgatgttcgtcggcgtctgctaccacgcctac
acgcgctacgcggagatccacaccggccgcgccacctggggccagttcggcctgacggtg
gcggtcggcgcgatcctcctggtcgtcggcgtctggctgctgaccaaagccaccggcgtg
ctgtaa

DBGET integrated database retrieval system