KEGG   Ralstonia pickettii 12D: Rpic12D_0679
Entry
Rpic12D_0679      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: ACS61980
UniProt: C6BE20
Position
1:709852..710544
AA seq 230 aa
MSRFKNEVMHLQAHVKTLRLFAAALFVVALLLGFGWWSAPKSLTIHVPPDLRSGSTRKWW
DVPPESVYAFTFYIWQQAQRWPTNGEQDYPRNLHGLSAYFTPSCRAFLQQDYEFRRSNGE
LRQRVRGIYEIPGRGYGDDPAARVRAVSANDWIVTLDVSADEYLGAEQVKRALVRYALKV
VRMDIDPERNPFGLVLDCYARAPERIETPPPPASAGKPASPGANLQGDTP
NT seq 693 nt   +upstreamnt  +downstreamnt
atgagccgcttcaagaacgaggtcatgcacctgcaggcgcatgtgaagacgctgcgcctg
ttcgccgccgcgctgtttgtcgtggcactgctgctcgggttcggatggtggagcgcaccc
aagagcctgaccatccacgtaccgcccgacctgcgctcaggcagcacccgcaagtggtgg
gatgtgccgccggagagcgtctacgccttcaccttctacatctggcagcaggcccaacgc
tggccgaccaacggcgagcaggactacccgcgcaacctgcatgggctgtcggcctacttc
acaccgagctgccgggccttcctgcaacaggactacgagttccggcgcagcaacggcgag
ttgcgccagcgcgtgcgcggcatctatgagattcccggccgcggctacggcgacgatccc
gccgcgcgcgtgcgcgccgtgtcggcgaacgactggatcgtcacgctggacgtgagcgcc
gacgagtatctgggcgcagagcaggtcaagcgcgcgctcgtgcgctacgcgctgaaggtc
gtgcgcatggacatcgatcccgagcgcaatcccttcggcctggtgctggactgctatgcg
cgtgcgcccgagcgcatcgaaactccgccgcccccggcgtcagccggcaagcccgccagc
cccggcgccaatctgcagggagacaccccatga

DBGET integrated database retrieval system