KEGG   Ralstonia pickettii 12D: Rpic12D_0680
Entry
Rpic12D_0680      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF3438
Other DBs
NCBI-ProteinID: ACS61981
UniProt: C6BE21
Position
1:710541..711458
AA seq 305 aa
MKRCFLPALAGVLFCLGFVPAGHAVEILRWERLPLAVPLVVGQERVVFIERNVRIGVPAG
VGEQLRVQSTGGAIYLRASAPVPPTRLQLQDVESGALILLDIAAEPAKAGQPALEPVRIV
DGDVPATRYGEPASPSATADDDAQRPTPAARRATPVAVVLTRYAAQNLYAPLRTVEPMAG
IGRVNLRRNLALDTLLPTLPVRAQALAVWRLEDQWVTAVKLTNTSGRWLDLDPRALQGDF
LAATFQHPTLGPAGRAADTTVVYLVTRGHGLAESLLPKVAPIDATVNLPPAAAGQAEGGG
ARDEK
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaagcgctgcttccttccggccctggccggtgttctgttttgcctgggtttcgtgccc
gcgggccatgccgttgaaatcctgcgctgggagcgcctgccgctggccgtgccgctggtg
gtcggccaggagcgcgtggtattcatcgagcgcaacgtgcgcatcggcgtgccggccggc
gtcggcgagcagttgcgcgtgcagagcacgggcggagcgatctacctgcgcgccagcgcg
cccgtcccgcccacgcggctgcaactacaggacgtggaatccggcgcgctgatcctgctg
gacatcgccgccgagccggccaaggcgggccagcctgcgctcgaacccgtgcgcatcgtc
gatggcgatgtgccggccacccgctacggcgagccggccagcccctcggccaccgcggac
gacgatgcgcagcgcccgacaccagccgcccgccgcgcaacgccggtggccgtggtgctg
acgcgctacgcggcgcagaacctgtacgcgccgctgcgcaccgtggagcccatggccggc
atcggccgcgtcaacctgcgtcgcaacctcgcgctggacaccttgctgcccacgctgccg
gtgcgcgcgcaggcgctggccgtatggcggctcgaagaccagtgggtgacggccgtgaag
ctcaccaacacctccggacgctggctcgacctcgatccgcgtgcgctgcagggcgacttc
ctcgccgcgaccttccagcacccgaccctggggccggccggccgcgcggccgacaccacc
gtggtctatctcgtcacccgtggccacggcctggccgagtcgctgctgcccaaggtggcg
ccgatcgacgcgacggtaaacctgccgccggcggcggccggccaggccgaaggaggagga
gcgcgcgatgaaaagtaa

DBGET integrated database retrieval system