KEGG   Ralstonia pickettii 12D: Rpic12D_0681
Entry
Rpic12D_0681      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: CENP-F_leu_zip YabA Macoilin
Other DBs
NCBI-ProteinID: ACS61982
UniProt: C6BE22
Position
1:711448..712917
AA seq 489 aa
MKSNPLLKWLLIPMALVLVFVGIKLFSGERSARPAPPGSANPLTPEEMKALGIEGDTPRD
TVATLVAQVKQLRNELQTALNDNKNQKTENERMRARESAIDQRIQSALDGERGRLQQDRE
QLAGDRQQTQGLLQDLQRRLDGLSGKSGQADLPVGLGLEEGDGKGFGGNQGGSARNTNGT
RWVEPDDAKPSAKNGSSGGLNFPTSFGPAQKTLSDTADGVASTVADAGSRAVGASSKPVY
TVPSNSTLMGSIAMTALIGRVPIDGTVNDPYPFKVLIGPDNLTANGIDIPDVAGAVVSGT
ASGDWTLSCVRGQIRSVTFVFNDGTIRTVPEDGNRNRSSGNQGNSANSTTQGGLGWISDP
YGIPCVSGERRSNAQQYLGSQALITAAGAGAASLIKSDNGSVAVVANSNGSLGTVGISGN
EAMGRILAGGVRDMADWVNKLYGQAFAAVYVRPGAKVAVHLEQPLNIDYDAKGRRVNHRI
GGAHASDLD
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgaaaagtaaccccctcctgaagtggctgctgatcccgatggcgctggtgctggtgttc
gtcggcatcaagctcttctcgggcgagcgcagcgccaggccggcacctcccggcagcgcc
aacccgctcacgcccgaagagatgaaggcgctcggcatcgaaggcgacacgccacgcgat
accgtcgccacgctggtggcccaggtcaagcagttgcgcaacgagctgcagacggcactc
aacgacaacaagaaccagaagaccgagaacgagcgcatgcgcgcgcgggaaagcgcgatc
gaccagcgcatccagtccgcgctcgacggcgagcgcggccgcctgcagcaggaccgcgag
cagttggccggcgaccgccagcagacccagggcctgctgcaagacctgcagcggcgcctg
gacggcctctccggcaagagcggccaggccgacctgccggtgggcctcgggctggaggaa
ggcgacggcaagggcttcggtggcaaccagggcggcagtgcgcgcaacaccaacggcacg
cgctgggtggagccggacgatgcgaaaccctcggcgaaaaacggcagcagcggcggcttg
aacttcccgaccagcttcgggccggcgcagaagacgctttccgacacggccgacggcgtg
gcaagcaccgtcgcggatgcaggcagccgcgccgtgggcgcatcgtccaagccggtctac
acggtaccgtcgaactcgacgctgatgggctcgatcgcgatgaccgcgctgatcggccgt
gtgccgatcgacggcacggtcaacgacccgtatcccttcaaggtgctgatcggccccgac
aacctcaccgccaatggcatcgacatccccgacgtggccggcgcggtggtcagcggcacg
gcctcgggcgactggacgctttcctgcgtgcgcggccagatccgctcggtcacgttcgtc
ttcaacgacggcacgatccgcaccgtgccggaggacggcaatcggaatcggagcagcggc
aatcagggcaacagcgcgaacagcacgacgcagggcggcctgggctggatcagcgatccc
tacggcatcccctgcgtcagcggcgagcggcgcagcaacgcgcagcagtacctgggctcg
caggccctcatcaccgcggccggggctggagcggcgtccctcatcaagtcggacaacggc
agcgtggccgtggtcgccaacagcaacggttcgctcggcaccgtcggcatcagcggcaac
gaggcaatgggccgcatcctggccggcggcgtgcgcgacatggccgattgggtcaacaag
ctctacgggcaggccttcgccgcagtctacgtgcggcccggtgccaaggtcgccgtgcat
ctggagcagccgctcaacatcgactacgacgccaaggggcgccgggtcaatcaccgcatc
ggaggtgcccatgcgtcggatttggattga

DBGET integrated database retrieval system