KEGG   Ralstonia pickettii 12D: Rpic12D_0682
Entry
Rpic12D_0682      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Other DBs
NCBI-ProteinID: ACS61983
UniProt: C6BE23
Position
1:712898..713332
AA seq 144 aa
MRRIWIESAAALCAVMVLGGCATSKDELLPHGDHTMLDVWNQETGGSAGGGQAARQLLDA
RQGLRRPLTEADVQAAPAAAAAYTRTAANEIYRQFHRLPNPDLVMYVFPHLAGTDPVPVP
GYTTVFPLYQRVQYAMPGERLEDY
NT seq 435 nt   +upstreamnt  +downstreamnt
atgcgtcggatttggattgaatcggccgcggccctgtgcgcggtcatggtgctgggcggc
tgcgccaccagcaaggacgagctgctgccgcacggcgatcacaccatgctcgacgtgtgg
aaccaggagacgggcggcagcgccggtggcggacaagccgcccggcaactgctcgatgcg
cgccagggcctgcgccggccgctgaccgaggccgacgtgcaggcggcgcccgccgccgct
gccgcctacacgcgcaccgcggccaacgagatttaccgccagttccaccggctgccgaac
ccggacctggtgatgtacgtgttcccgcacctggccggcaccgacccggttcccgtgccc
ggctacaccaccgtgttcccgctctaccagcgcgtgcagtacgcgatgcctggcgagcgc
ctggaggactactga

DBGET integrated database retrieval system