KEGG   Ralstonia pickettii 12D: Rpic12D_0684
Entry
Rpic12D_0684      CDS       T00925                                 

Definition
(GenBank) DSBA oxidoreductase
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: Thioredoxin_4 DSBA
Other DBs
NCBI-ProteinID: ACS61985
UniProt: C6BE25
Position
1:716228..716974
AA seq 248 aa
MRIPRFAPSRTVLVVALLAAAALTTAAWLGLRPPSPPAEPDSPSAEATPAPATAPAGPPW
RYGRADARFTVVEYADLECPFCRAYFAVLKRWIDAHPDVSWQWHHLPLPLHEPAASAGAR
LVECVGEAGGQAAFWQAAEWVYTHTRGDGQGLPEGLRYPDLTPAAQHCLDSDRPDTLIRA
QSASAAQEGIKVTPTLRLQDRQSGKTLLLHGPVEGDALLSAIDLLAAGAATEPASKEMPA
ESLGDMPR
NT seq 747 nt   +upstreamnt  +downstreamnt
atgcgcatccctcgcttcgcgccgtcccgcaccgtccttgtcgtcgcgctgctggcggcc
gcggccctgaccacggccgcgtggctcggcctgcggccgccgtcgccacccgccgagccc
gattctccttcggcagaagcaacgcctgcgccggcaacggcgccagccggcccgccctgg
cgctatggccgcgccgatgcgcgcttcacggtggtcgagtacgccgacctcgaatgcccg
ttctgccgcgcgtacttcgcggtgctcaagcgctggatcgacgcgcaccctgacgtgagc
tggcaatggcaccacctgccgttgccgttgcacgagccggcggcgtccgccggtgcgcgc
ctggtggagtgcgtcggcgaggccggcggccaggccgcgttctggcaggctgccgagtgg
gtctacacgcacacccgtggcgacggtcagggcctgcccgagggcctgcgctatcccgac
ctcacgccggccgcgcagcactgcctcgacagcgaccgccccgacacgctgatccgcgca
cagtcggcgagcgcggcgcaggagggcatcaaggtcacgcccacgctgcgcctgcaggat
cgccagtccggcaagacgctgctgctgcacggcccggtcgaaggagatgccttgctgtcc
gcgatcgacctgctggcggccggtgcagcgaccgaacccgcatcgaaggaaatgcctgcc
gagtctctcggcgacatgcccaggtag

DBGET integrated database retrieval system