KEGG   Ralstonia pickettii 12D: Rpic12D_0685
Entry
Rpic12D_0685      CDS       T00925                                 

Definition
(GenBank) DNA repair protein RadC
  KO
K03630  DNA repair protein RadC
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Rpic12D_0685
SSDB
Motif
Pfam: RadC Prok-JAB
Other DBs
NCBI-ProteinID: ACS61986
UniProt: C6BE26
Position
1:717169..717663
AA seq 164 aa
MSYVVADSCPESLSLIAAQHEDWIIRQAITLLEQRIFKAGPMLNSPAAVRDYLHLKLVAE
PNEVFSVVFLNCQHQVLAYEPMFKGTVDQTSVYPRVLVQRALALNASAVILAHQHPSGMT
VPSAADQVLTDRLKAALAMVDVRVVDHLIVGKGTPYSFAESGLL
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcctatgtcgtcgccgactcgtgtcccgagtcgctcagcctgatcgccgcccagcac
gaagactggatcatccgccaggccatcaccttgctggagcaacgcatcttcaaggccggt
ccgatgctgaacagtcccgccgccgtgcgcgactacctgcatctgaagctggtcgcggag
cccaacgaggtcttctccgtcgtgttcctcaactgtcagcaccaagtcctcgcctacgag
ccgatgttcaagggcacggtcgatcaaacctcggtgtacccgcgggtgctggtgcagcgc
gccctggccctcaacgcctcggcggtcatcctggcccaccagcatccatccggcatgacc
gtgccatcggccgccgatcaggtgctgaccgaccggctcaaagccgccctggcgatggtc
gatgtccgggtggtggatcacctcatcgtcggcaaaggcacgccgtactccttcgccgaa
tccggcctgctgtag

DBGET integrated database retrieval system