KEGG   Ralstonia pickettii 12D: Rpic12D_0686
Entry
Rpic12D_0686      CDS       T00925                                 

Definition
(GenBank) protein of unknown function DUF1525
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF1525
Other DBs
NCBI-ProteinID: ACS61987
UniProt: C6BE27
Position
1:717821..718267
AA seq 148 aa
MTAPFLKPIPRLRATRIACAGGLLLCLLGQDASAADVLVVTDSRHPVQSASGARVIELDL
PERIEAELAAGLPADPGRAAALVQQRLRDGGQALQRRIGSAYQGVADAWGLGLAKVPAVV
VDRRYVVYGEPDVARAVARIESHRRAQP
NT seq 447 nt   +upstreamnt  +downstreamnt
atgacggctcccttcttgaaacccatcccgcggctgcgggccacgcgcatcgcctgcgcg
ggagggctgctgctgtgcctgctcggacaggacgcatccgcagccgacgtgctggtcgtg
accgacagccgccatcccgtgcagtccgcatccggcgcgcgcgtgatcgagctggacctg
cccgagcgcatcgaggccgagctggccgcgggcctgcctgccgatccgggccgcgcggcc
gcgctcgtgcagcaacgcctgcgcgatggcggccaggcactgcagcgccgcatcggcagc
gcctaccagggcgtcgccgacgcctggggcttagggctggccaaggtgcccgccgtggtg
gtcgatcgccgctacgtggtctacggagagcccgatgtcgcgcgcgccgtggcccgcatc
gaatcccaccggagggcacagccatga

DBGET integrated database retrieval system