KEGG   Ralstonia pickettii 12D: Rpic12D_0687
Entry
Rpic12D_0687      CDS       T00925                                 

Definition
(GenBank) protein of unknown function DUF1527
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: ACS61988
UniProt: C6BE28
Position
1:718264..719214
AA seq 316 aa
MNRLLSASSRRARLAIASVLLGGAASTFALNTATIVSSALSPDCLEYRVVGICYWLFCTW
TGCTVRTSVKVRHYVPDAVVSSYSNTGENPWIEVRAMSMPNPTAQAGGDGTTNHDNENNL
AKFKNADVIGHPGGSVFSQFASASGYACQGAGTAFMPYLLSTLDTLAWRYNVPEMVYPEA
LIPGMREIGGRTTLNLWGNVYPRGGFLHQTDDYKSGAVVAQRAGDVVTRRMQPHVYQPLL
ASSSDGYWPAGALMESDASTGKWQELTPTLSNSCAVFPHSNTRVQAQQGDYAWALWRPYA
CCQRRGQVFLGSVDFL
NT seq 951 nt   +upstreamnt  +downstreamnt
atgaaccgcctgctgtcggcgtcgtcgcgccgggcccgccttgccatcgcctcggtgctg
ctcggcggcgccgcttcgacgttcgcgctgaacacggccaccatcgtgtcctcggccctg
tcgcccgactgcctggagtaccgcgtggtcggcatctgctactggttgttctgcacctgg
acgggctgcacggtgcgcacctcggtgaaggtgcgccactacgtgcccgacgccgtggta
tcgagctacagcaacaccggcgagaacccgtggatcgaggtgcgcgccatgagcatgccc
aaccccacggcgcaggccggcggcgacgggacgacgaaccacgacaacgagaacaacctg
gcgaagttcaagaacgccgacgtgatcgggcatcccggtggctcggtattcagccagttc
gccagcgcctccggctacgcctgccagggcgcaggcacggccttcatgccgtacctgctg
agcaccctcgacacgctggcctggcgctacaacgtgccggagatggtgtaccccgaggcg
ctgatccccggcatgcgcgagatcggcggccgcacgacgctcaacctgtggggcaacgtc
tatccgcgcggcggcttcctgcaccagaccgacgactacaagagcggcgccgtcgtcgcg
cagcgcgcgggcgatgtcgtcacgcggcgcatgcagccgcacgtctaccagccgctgctc
gcgagttcgagcgacggctactggccggccggcgccctgatggagagcgatgcctccacg
ggcaagtggcaggagctgacgccgaccctctccaactcctgcgctgtgttcccgcacagc
aatacgcgcgtgcaggcccagcaaggcgactacgcctgggcgctgtggcggccctatgcc
tgctgccagcgccgcgggcaggtcttcctcggcagcgtcgatttcctctga

DBGET integrated database retrieval system