KEGG   Ralstonia pickettii 12D: Rpic12D_0688Help
Entry
Rpic12D_0688      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DivIC
Motif
Other DBs
NCBI-ProteinID: ACS61989
UniProt: C6BE29
Position
1:719224..720627
Genome map
AA seq 467 aa AA seqDB search
MKASLSRFAQRARPYALSIALACAVTAAAGVAWAQTRIGPTGVGVSGSVIGDDVLYSIGG
GRAVSMGGAGNMQSIGVGIGWNSNLICGNMSITTTLQNQLNGLTNGFQQIMSSVIQSATS
AVASLPALIIQRADPGLYNLLTNGVLQARLDFDRSKLTCKAMANRMADMAGGQAGWDQLA
EGFALRDAVSSTDAVSAVEQAESNKGNNGVPWVGGGNAGGSGQGSIKVVGDVTRAGYNLL
NSRGVSDTSSIPRASCGNRLTCQTWSSPQAAADFATRVLGEREQRTCETCTKTQTTPGVG
LTPVIQEEYETKLQALQELVTGAKPTTVANLEAAGSNSLPITRGVIEALRDEPDQDLLGK
RLASEAALSSVLEKALLLQRTLLTGKKEPNVAANELAVKAVDQENTALEQEINNLKTELE
LRRTLAGNSAMAIVQRHGTRAAGSRGIFEGDTTRDRLKEVQKPRSGP
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgtccctttcccgtttcgcacagcgcgccaggccctacgcgctcagcatcgcg
ctcgcctgcgccgtcacggccgcagccggcgtcgcctgggcgcagacccgcatcggcccc
accggcgtcggcgtgagcggcagcgtcatcggcgacgacgtgctctacagcatcggcggc
ggccgggccgtgtccatgggcggcgccgggaacatgcagagcatcggcgtgggcatcggc
tggaacagcaacctgatctgcggaaacatgagcatcacgacgacgctgcagaaccagttg
aacggcctcaccaatggctttcagcagatcatgtcctcggtgatccagagcgccaccagc
gccgtggcgtcgctgccggccctgatcatccagcgtgccgatccgggcctctacaacctg
ctgaccaacggcgtgctgcaggcgcggctcgatttcgaccgcagcaaattgacgtgcaag
gcgatggccaaccggatggcggacatggccggcggccaggccgggtgggatcagctcgcc
gaaggtttcgcgctgcgcgatgcggtgagcagcaccgatgcggtgtccgccgtcgagcag
gccgaatcgaacaagggcaacaacggcgtgccctgggtgggcggcggcaacgcgggcggc
tcgggccagggttccatcaaggtggtcggtgatgtgacccgtgccggctacaacctgctc
aacagtcgcggtgtcagcgacacctcatccatcccgcgcgcgtcctgcggcaaccggctg
acctgccaaacctggtcctcgccgcaggccgcagcggacttcgcgacccgcgtgctcggc
gagcgcgagcaacgcacctgcgagacctgcaccaagacgcagacgacgcctggcgtcggc
ctgacgccggtgatccaggaagagtacgagaccaagctgcaggcgctgcaggagctggtg
acgggcgcgaagccgacgacggtggcgaacctcgaagccgccggcagcaactcgctgccg
atcacgcgcggcgtgatcgaggcgctgcgcgacgaacccgatcaagacctgctcggcaag
cgcctggcgtccgaagccgcgctgtcgagcgtgctggagaaggccctgctgttgcagcgc
acgctgctgaccggcaagaaggagcccaacgtcgccgccaacgagctggccgtgaaggcc
gtcgatcaagagaacaccgcgctggagcaggagatcaacaacctcaagaccgagctggag
ctgcggcgcacgctggccggcaattcggcgatggcgatcgtgcagcgccacggcacccgc
gccgcgggctcgcgcggcatcttcgagggcgacacgacgcgcgaccgcctcaaggaagtg
cagaagccgcggagcgggccatga

DBGET integrated database retrieval system