KEGG   Ralstonia pickettii 12D: Rpic12D_0689
Entry
Rpic12D_0689      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: CopD SpoIIM
Other DBs
NCBI-ProteinID: ACS61990
UniProt: C6BE30
Position
1:720624..720977
AA seq 117 aa
MTSRAWLRPAWLLGRRVGIVLLWVLLVAGIAVGVNVVGLHVVGSIDGWEQWLREHSGHFL
VWRLLLYAATACGWWWMRRRLREREPSAEAHQRLLRVEIAAVATLVLLEGSQLLRNG
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaccagccgggcctggctgcggccggcatggctgctcggccgccgcgtcggcatcgtg
ctgctgtgggtgctgctggtggcgggcatcgcggtcggcgtgaacgtcgtcggcctgcac
gtcgtcggcagcatcgacggctgggagcagtggctgcgcgagcactcgggccacttcctc
gtctggcggctgctgctctacgcggcgacggcctgcggctggtggtggatgcgtcggcgc
ctgcgcgaacgcgagccgtcggccgaggcgcaccagcgcctgctgcgcgtcgagatcgcg
gccgtcgccaccctcgtgctgctcgaaggcagccagctactgcgcaatggctga

DBGET integrated database retrieval system