KEGG   Ralstonia pickettii 12D: Rpic12D_0690
Entry
Rpic12D_0690      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: ACS61991
UniProt: C6BE31
Position
1:720993..722510
AA seq 505 aa
MTLNTTDYLEYYLTLVGWIVSNGIWNILVASGVFALPFVVIVVQEWLRARAEGADEGNKG
VLSSMRIENRVWVAIVVILFAGIPFIPVDLSTIKFDTTRSAQCQVSVPQPTDTGWSNAYT
TLNNQSALVPVWWFFMHAISKAVTGGAVAAIPCGTDLRQMRMDVDATRIDDPVLAQEVGD
FVHDCYGPSRAKLFMSRPALSDEQMNDVTWIGSSYFLNNAGFYDTYHSNTPRTAWPYDAT
RDAGLAQVDSGGGYPTCRQWWSDGGSGLRARLLAQVDPDLLTRIGRWAGFLSQAEVNDSV
IRAVVSPRQQKMNQGSVYTDYGGQIEKTLPNVVTRGAGDLGMTMGSLGFFPAMDVVRQAL
PMVLSLLKMALVICIPLVLVFGTYELKALVAVSCVQFALFFVDFWFQLARWLDSTILDAL
YGWGFGANRPHSNFDPLIGLNNAFGDMLLNFVMATMFIVLPTFWVAALGWVGVRAGTAIQ
GLAAGTRDAQAAGGRGAGVAMKAAK
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgacgctcaacacaacggactacctggagtattacctgaccctggtcgggtggatcgtc
agcaacggcatctggaacatcctcgtggccagcggcgtgttcgcgttgccgttcgtggtc
atcgtggttcaggaatggctgcgcgcgcgggccgagggcgccgacgagggcaacaagggg
gtgctgtcctcgatgcgcatcgagaaccgcgtgtgggtggcgatcgtcgtcatcctgttc
gccggcattcccttcattccagtcgacctcagcaccatcaagttcgacacgacgcgctcc
gcgcaatgccaggtcagtgtcccgcagcccaccgacacgggatggtcgaacgcctacacc
acgctcaacaaccagagcgcgctggtgccggtgtggtggttcttcatgcacgccatctcg
aaggcggtgacgggcggcgcggtggcggccatcccctgcgggacggatctgcgtcagatg
cgcatggacgtggatgccacgcgcatcgacgacccggtgctggcccaggaggtcggcgac
ttcgtgcatgactgctacggcccctcgcgcgccaagctgttcatgtctcggcccgcactc
tccgacgagcagatgaacgacgtgacctggatcggttcgagctacttcctgaacaacgcg
ggcttctacgacacctaccactccaacacgccgcgcacggcctggccctacgacgcgacg
cgcgatgcagggctggcccaggtggacagcggcgggggctaccccacgtgccggcagtgg
tggtcggacggcggcagcggcttgcgcgcgcgcctgctggcccaggtcgatcccgacctg
ctgacgcgcatcggccgctgggcgggcttcctgtcgcaggccgaggtgaacgactcggtg
atccgcgccgtggtctcgccgcggcagcagaagatgaaccagggttcggtctacaccgac
tacggcggccagatcgagaagacgctgcccaacgtcgtgacgcgcggcgccggcgacctg
gggatgaccatgggctcgctgggcttcttcccggcgatggacgtggtgcgccaggcgctg
ccgatggtgctgtcgctgctcaagatggcgctggtgatctgcatcccgctggtgctggtc
ttcggcacctacgagctgaaggcgctggtcgcggtgagctgcgtgcagttcgcgctgttc
ttcgtggacttctggttccagctcgcgcgctggctggattccaccatcctcgatgcgctc
tacggctgggggttcggcgcgaaccggccgcacagcaacttcgatccgctgatcggcctg
aacaacgccttcggcgacatgctgctgaacttcgtcatggcgacgatgttcatcgtgctg
cctaccttctgggtggctgcgctgggctgggtaggcgtgcgcgcgggaacggcaattcaa
gggctggcggcaggaaccagggatgcccaagctgctggcggcaggggtgcgggtgtcgct
atgaaagcagcgaagtaa

DBGET integrated database retrieval system