KEGG   Ralstonia pickettii 12D: Rpic12D_0691
Entry
Rpic12D_0691      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: DUF3742 Ponericin Mfp-3
Other DBs
NCBI-ProteinID: ACS61992
UniProt: C6BE32
Position
1:complement(722516..722887)
AA seq 123 aa
MKTAAQTTFAERLGRTLGRAWRGCARLDQRAQGWLLARGWAPGIAKAALLAVKLAAIGVL
LYTAFWLALLLAFALVGAWVVRNDDASYDEEHKPEWRYGPAGYGLYTHDDYRIDPHDPED
EQA
NT seq 372 nt   +upstreamnt  +downstreamnt
atgaagaccgccgcacagaccaccttcgcagaacgcctcggccggacactgggccgggcg
tggagaggctgcgcgcgtctggatcagcgggcgcagggctggctgctcgcgcggggatgg
gcgcctggtattgccaaggccgcgctgctggccgtcaagctcgctgcgatcggtgtcctg
ctctacaccgcgttctggctggcgctgttgcttgcgttcgcgctggtcggcgcctgggta
gtccgcaacgacgatgcgagctacgacgaggaacacaagccggaatggcgatacggccct
gccgggtacggcctctacacccatgacgattaccggatcgacccccacgatccagaagac
gagcaagcctag

DBGET integrated database retrieval system