KEGG   Ralstonia pickettii 12D: Rpic12D_0693
Entry
Rpic12D_0693      CDS       T00925                                 

Definition
(GenBank) transcriptional regulator, AbrB family
  KO
K19156  antitoxin PrlF
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:rpf02048]
    Rpic12D_0693
Prokaryotic defense system [BR:rpf02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YhaV-PrlF
    Rpic12D_0693
SSDB
Motif
Pfam: PrlF_antitoxin MazE_antitoxin
Other DBs
NCBI-ProteinID: ACS61994
UniProt: C6BE34
Position
1:complement(723438..723755)
AA seq 105 aa
MPEIHEVATLTSKGQITLPKSIRQALGVDTGGKVAFDLRGGEVVVTRADADHEDPAIGAF
LGLLEADIRAGRHVQSLPDDLARAMLANAHHAVNLDEDIEGEVAL
NT seq 318 nt   +upstreamnt  +downstreamnt
atgcccgaaatccacgaagtcgcgacgctgacctccaagggtcagatcacgctgcccaag
tccatccggcaagcgctgggcgtggacaccggcggcaaggtggcgttcgacctgcgcggc
ggcgaagtcgtcgtgacccgcgccgacgccgaccatgaagacccggccatcggcgccttc
ctggggctgctggaagcggacatccgggccgggcggcacgtccagtccctgccggacgat
ctggcgcgggccatgctggccaacgcgcaccacgcggtgaacctcgatgaagacatcgaa
ggcgaagtggcgctctga

DBGET integrated database retrieval system