KEGG   Ralstonia pickettii 12D: Rpic12D_0694
Entry
Rpic12D_0694      CDS       T00925                                 

Definition
(GenBank) Relaxase
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: TraI_2 TraI_2_C
Other DBs
NCBI-ProteinID: ACS61995
UniProt: C6BE35
Position
1:724069..725916
AA seq 615 aa
MLSLFQRKRVSPAASAPTPKPPAEPGKGLMRPEPAASLLAAPRRQKLLEHIWQRTSLSRR
QFVTLYLAPLERYAELVQQFPASEAHHHAYPGGMLDHGLEIVAYALKLRQSHLLPAGATP
ETQAAQAEAWTAGTAYAALLHDIGKIAVDLHVEYADGTVWHPWHGPLRRPYRFRYRRERE
YRLHSAATGLLYARLLDPGIFDWLAGYPDLWAALLYVLAGQYEHAGMLGELVVQADQASV
AQELGGDPSKALAAPRHALQRKLLDGLRYLLKEEFKLNQPQASDGWLTQDALWLVSKTVS
DKLRAHLLSQGIDGIPASNTAVFNVLQDHGIALATPDGKAIWKATVTSDAGWSHSFTFLK
LSPAMVWDAADRPAPFAGRVQADEEPGAPTPQAPAAEAPGLESADTVPPSTAPTAPVPAD
NGVAALLDLLSDTAPPVAPEAPSDPEPASPPAPTVLPQVSPAPSQDRPEPSGEHFMAWLR
QGIQTHKLIINDAKALVHSVVGTAYLVSPGVFQRYAQEHLQIAALAKPENLEGWQWVQKR
FEKLGLHRKQASGLNIWTCEVTGPRKSRRLHGYLLSAPEALFQEMPPDNPYLRLLTEAVK
RENSAAGNKNDNEQG
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgctttcgctgttccaacgcaaacgggtgtcgcctgccgccagtgcgccaacgcccaaa
cctcccgccgagcccggcaaagggctgatgcggccggagccggccgcatcgctgctggcg
gcaccgcgccgacagaagctgctggaacacatctggcagcgcacctcgctgtcgcgccgg
cagttcgtcacgctgtacctcgccccgctggaacgctacgccgagctggtccagcaattc
cccgcgtcggaggcccatcaccacgcctatccgggcggcatgctggaccacggcctggag
atcgtcgcctacgcgctcaagctgcggcagtcgcatctgctgcccgccggcgccacgccg
gagacgcaagccgcccaggccgaggcctggaccgcaggcaccgcctacgcggcgctgctg
cacgacatcggcaagatcgcggtcgacctgcacgtcgagtacgcagacggcacggtctgg
cacccctggcacggcccgctgcggcggccgtaccgcttccgctaccgcagggagcgcgaa
taccggctgcacagcgccgccaccgggctgctctacgcccggctgctcgatccgggcatc
ttcgactggctcgccggctatcccgacctctgggccgcgctgctgtacgtgctggccggc
cagtacgagcatgccggcatgctcggagaactggtcgtgcaggcggaccaggcatcggtc
gcccaggaactcggcggcgatccgagcaaggccctggcagcgccccggcacgcactgcag
cgcaagctgctcgatggcctgcgctacctcctgaaggaagagttcaagctgaaccaaccc
caggcctcggatggctggctgacccaggacgcgctctggctggtgagcaagaccgtctcg
gacaagttgcgcgcgcatctgctgtcgcagggcatcgacggcatcccggccagcaacacg
gcggtgttcaacgtgctgcaggatcacggcatcgccttggccacaccggacggcaaggcg
atctggaaggccaccgtcaccagcgatgccggctggtcgcacagcttcaccttcctgaag
ctgtctccggccatggtctgggatgcggcagaccggccggcaccgttcgcgggtcgcgtg
caggctgacgaggaaccaggggcgccgacgccacaggcaccggcagccgaagcgccgggc
ttggaaagcgccgataccgtgccaccgagcaccgcgccgaccgcgcccgtgcccgccgac
aacggcgtggccgcgctgctcgatctgctgagtgacacggccccacccgtagcgccggag
gctccgagcgaccccgagccggcctcgccaccggcgcctacggtgctgccgcaggtgagc
cccgcgccatcccaggatcggccggagccttccggcgagcatttcatggcctggctgcgt
cagggtatccagacgcacaagctcatcatcaacgacgccaaagccttggtgcatagcgtc
gtgggaacggcctacttggtgagccccggcgtcttccagcgctatgcgcaagaacatctg
caaattgccgcactggcgaaaccggagaacctggagggatggcagtgggtgcagaagcgt
tttgagaagctgggcctgcaccgcaagcaagcaagcgggctgaatatctggacctgcgaa
gtcacggggccgcgcaaatccaggcgactgcacggctacctgctgagcgctcccgaagcg
ctgttccaggaaatgcctccggacaatccatacctgcgcctcctcaccgaggccgtaaag
cgcgaaaattcagccgccggtaataagaacgacaacgaacaggggtag

DBGET integrated database retrieval system