KEGG   Ralstonia pickettii 12D: Rpic12D_0697
Entry
Rpic12D_0697      CDS       T00925                                 

Definition
(GenBank) integrase family protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: Arm-DNA-bind_3 Phage_integrase Phage_int_SAM_3
Other DBs
NCBI-ProteinID: ACS61998
UniProt: C6BE38
Position
1:complement(727012..728868)
AA seq 618 aa
MALSDLVVRQAKATGKAYTLPDIDGLSLAVTTTGSKSWHFRYYWMKEPKRMSLGTYPEVS
LREARALRDEARALVAKDINPRLHRKQKRAAVKLAGENTFEAIYKKWLAHRELGLKKGRQ
TTLSILPRVFAKDVLPLLGKRSIYDIKRPDLLEVIARIERRKALSVAEKVRTWFNQMFRY
ALVVVPGLEQNPASDLDVVALPLPPVNHNPFLRMAELPKLLQRLRKYRGRLQTQLGLRLL
LFTGVRTGELRLATPDQFDLDRGLWIIPPEVVKQLQVDMRRKRQLPKDIPPYIVPLSVQA
IEIVRHLLEQFKPAQHYLFRHDSELKKRMSENTLNGALKRMGYRDLLTGHGIRGTMSTAL
NEIGYPKVWVDAQLSHVDPNKVSATYNHAEYVEQRRRMMQDWADRLDLFEQNMVEAASMP
LTIHLEGVPVLSDEEAASAPPKAAATSAPLLIVTKPGDAMPLVSAETHRLPAVPLPRSVM
EEPLSDIQRQRMELVDVFEAPHNLPVAEYAKMAGKSRRWISYEIKAGNLLALNLGNRGQR
VPDWHLDPVKHALIQAVLKLTRGADPWQIYNALLQPRAMLRGRSALESVSATNLDKIIMA
VSTTVKESEWSPQQVAFA
NT seq 1857 nt   +upstreamnt  +downstreamnt
atggcactctcagacttggtggtccgccaagccaaggccaccggcaaggcttacaccctt
ccagacatcgatggtctctccctggccgtgacgaccacgggtagcaagagctggcacttc
cgttactactggatgaaggagcccaagcgcatgtcgctgggcacctatcccgaggtgtcc
cttcgtgaggcacgcgccctgcgtgacgaggcacgcgccttggtggccaaggacatcaac
ccgcgtcttcaccgcaagcaaaagcgcgccgcggtcaaactcgctggtgaaaacaccttc
gaggcgatctacaagaagtggcttgcacaccgcgaactcggcctcaagaagggccggcag
accacgctctcgatcctccctcgcgtcttcgccaaggatgtgctgcccttgctgggcaag
cgctcgatctacgacatcaaacgccctgacttgctggaagtgatcgccaggattgagcgg
cgcaaggcgctctccgtcgccgagaaagtcaggacgtggttcaaccagatgttccgctac
gcgctggtggtcgtgccgggcttagagcagaacccggcctccgacctcgacgtggtggcg
ctgccgctgccccccgtgaatcacaacccgttcctgcgcatggccgagttgccgaagctg
ctgcagcgcttgcgcaagtatcgtggccggctgcagacccagctcggtctgcggttgctg
ctattcaccggcgtgcgcacgggcgagctgcgcctggcgacgccggatcagttcgacctc
gatcggggtctgtggatcatcccgcccgaggtcgtgaagcagctccaggtggacatgcgc
aggaagcgccagttgcccaaggacattccaccctacatcgtgccgctatcggtgcaagcc
atcgagatcgtccggcacctactggaacagttcaaaccggcccagcactatctgttccgg
cacgacagcgagttgaagaagcgcatgagcgagaacacgctcaacggtgcgctcaagcgc
atgggctatcgcgacctgctgaccgggcacggcatccggggcacgatgtccaccgcgctc
aacgagatcggctacccgaaggtgtgggtggatgcgcagctctcgcacgtcgatcccaac
aaggtcagcgccacctacaaccacgccgagtacgtcgagcagcggcggcggatgatgcag
gactgggccgaccggctcgatctcttcgagcagaacatggtcgaagcagcgagcatgccg
ctcaccattcatctggagggcgtacccgtcctctcggacgaggaagccgcgagcgcgcca
cccaaggcagcggccacgtcggcgccgctcctgatcgtgaccaagccgggagacgcgatg
ccactggtgtcggccgagacgcatcggctgcccgcagtgccgttgccgcgctccgtcatg
gaggaaccgctgtccgacattcagcgccagcggatggaactggtcgatgtcttcgaggca
ccgcacaacctgccagtcgccgagtacgcgaagatggcgggcaagtcccgccggtggatc
agctacgagatcaaggccggcaacctgctggcgctgaacctgggcaaccgtggtcagcgc
gtgccggattggcatctcgatccggtcaagcacgcgctgatccaggcggtcctcaagctg
accaggggcgccgacccttggcagatctacaacgcgctcctgcagccgcgcgcgatgctg
cgcggccgctcggccctggaaagcgtcagcgccacgaatctcgacaagatcatcatggcg
gtgagcacgacggtgaaggaaagcgagtggtccccgcagcaggtggcgtttgcgtag

DBGET integrated database retrieval system