KEGG   Ralstonia pickettii 12D: Rpic12D_0699
Entry
Rpic12D_0699      CDS       T00925                                 

Definition
(GenBank) acetoacetyl-CoA synthase
  KO
K01907  acetoacetyl-CoA synthetase [EC:6.2.1.16]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00280  Valine, leucine and isoleucine degradation
rpf00650  Butanoate metabolism
rpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Rpic12D_0699
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rpic12D_0699
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rpf01004]
    Rpic12D_0699
Enzymes [BR:rpf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.16  acetoacetate---CoA ligase
     Rpic12D_0699
Lipid biosynthesis proteins [BR:rpf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rpic12D_0699
SSDB
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Other DBs
NCBI-ProteinID: ACS62000
UniProt: C6BE40
Position
1:complement(730083..732137)
AA seq 684 aa
MSTIQEGALLWTPSADFIARARLTHYLDWLARERGLRFSATTPEGYARLWEWSTTELEAF
WTSVWDYLDLRASTPFTQMLGDRTMPGAQWLVGAKLNYVDQVMRHVEEGGSPDRTAIRYA
SETKPLADLSWRELRQRVASLADALRKMGVVPGDRVAAYLSNTPDAMVAFLATASVGAIW
SVCAPDMGQVAVTDRFRQIEPKVLIAVDGYHYGGRAFDRADVVAEMVDALPTVEHLVLVP
QLLGEINRARFPEAHDWRDLTADDVPLVVTPVAADHPLWILYSSGTTGMPKPIVHGHGGL
LLVQTMMGALHLDLGPDDVYHWYSSTGWVMWNSQASGLLGGVTLAIYDGNPGTPDLNTLW
RFAQDAGVTFFGAGAAFFANCLKAGIEPGRDFGLSKLRAVGSTGSPLSAEAYDWIYRHVK
ADVWLNPISGGTDFAGCFVGGVATLPVYAGEMQCRNLGSRVEALDEAGHPLIDAVGELVC
TAPIPSMPLFFWGDTDGSRYRDSYFDMYPGRWRHGDWIKITPRGGAIIYGRSDATINRHG
IRMGTAELYRVVEDLPEVLDSLVVDLEFLGRESFMPLFVVLREGATLDDTLRSTINARIK
AGLSARHVPNVIVQAPGVPRTLSGKKMEVPIKKLLLGAPVERVAHPDAMANPEVLAWYAA
YAGSLARQSSAHGEPAPALESWRS
NT seq 2055 nt   +upstreamnt  +downstreamnt
atgagcactatccaggaaggcgccctgctatggacgccatcggcggacttcatcgcgcgc
gcgcgcctgacgcattacctcgactggcttgcgcgcgaacgcgggctgcgcttttcggcg
accacgcccgagggctacgcacgactctgggaatggtcgaccactgaactcgaggcgttc
tggacgtccgtctgggactacctcgacctgcgcgcctcgacaccgttcacgcagatgctg
ggcgaccgcaccatgcccggcgcgcaatggctggtcggcgcgaagctcaattacgtcgat
caggtcatgcgccatgtggaagaaggcggcagccccgaccgcaccgccatccgatacgcc
agcgagaccaagccgctggccgacttgtcatggcgcgaactgcgccaacgcgttgcctcg
ctggcggatgcgctgcgcaagatgggcgtggtgccaggcgaccgcgtcgccgcatatctg
tcgaacacgccggacgcgatggtggcgtttctcgccacggccagcgtcggggccatctgg
tctgtctgtgcgcccgacatgggccaggtggccgtgaccgaccgcttccgccagatcgag
cccaaagtgctgattgcggtggacggctatcactacggcggccgcgcgttcgaccgcgcc
gacgtggtcgcagagatggtcgacgcgctgccaacagtcgaacacctcgtgctcgtgccg
cagttgcttggcgagatcaaccgcgcacgtttcccagaggcccacgactggcgcgacctg
acggccgacgacgtgccgctcgtcgtcacacccgttgccgctgaccacccactgtggatt
ctctattcgtccggcaccaccggcatgcccaagccgatcgtgcacggccacggcggcttg
ctgctcgtgcagacgatgatgggcgcgctgcatctcgaccttggccccgacgacgtctac
cactggtacagcagtaccgggtgggtcatgtggaattcgcaagcgagcggcctgctgggc
ggcgtcacgctcgccatctacgacggcaaccccggcacgcccgatctcaatacgctgtgg
cgcttcgcacaggatgcgggcgtgaccttctttggcgccggggcggcgttcttcgccaat
tgcctgaaggccggcatcgagcccggtcgcgatttcggcttgtcgaagctgcgcgcggtt
gggtcgacgggctcgccgctctccgccgaggcgtatgactggatctaccgccacgtgaag
gccgatgtctggctcaatccgatttccggcggcaccgatttcgccggatgcttcgtgggc
ggcgtcgccacgctgcccgtctatgcaggtgagatgcaatgccgcaacctcggctcgcgt
gttgaagccctggacgaggccggccacccgctgatcgatgcagtgggcgaactggtctgc
acggcaccaatcccatcgatgccgctgttcttctggggcgataccgatggcagccgctac
cgcgacagctacttcgacatgtaccccggccggtggcgccatggcgactggatcaagatc
accccgcgcggcggcgccatcatctacggccggtcggatgccacgatcaaccgccacggt
atccgcatgggcacagccgagctgtaccgcgtagtggaagacctgccggaagtgctcgac
agcctcgtcgtcgatctcgaatttctcggccgcgaatcgttcatgccgctgttcgtcgtg
ctgcgcgaaggtgcaacgctcgacgacacgctgcgcagcacgatcaacgcgcgcatcaag
gcgggactgtcggcccggcatgtgcccaacgtgatcgtgcaggcgccaggcgtgccgcgc
acgctctcgggcaagaagatggaagtacccatcaagaaactgctgcttggcgcaccagtc
gagcgcgtcgcccaccccgatgcaatggcaaacccggaggtgctcgcgtggtacgcggcc
tacgccgggtcgctggctcggcaaagcagcgcgcacggcgagcccgcgcccgcattggaa
tcgtggcggagctag

DBGET integrated database retrieval system