KEGG   Ralstonia pickettii 12D: Rpic12D_0700
Entry
Rpic12D_0700      CDS       T00925                                 

Definition
(GenBank) succinic semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00250  Alanine, aspartate and glutamate metabolism
rpf00310  Lysine degradation
rpf00350  Tyrosine metabolism
rpf00650  Butanoate metabolism
rpf00760  Nicotinate and nicotinamide metabolism
rpf01100  Metabolic pathways
rpf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Rpic12D_0700
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rpic12D_0700
   00310 Lysine degradation
    Rpic12D_0700
   00350 Tyrosine metabolism
    Rpic12D_0700
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rpic12D_0700
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     Rpic12D_0700
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     Rpic12D_0700
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     Rpic12D_0700
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: ACS62001
UniProt: C6BE41
Position
1:complement(732218..733729)
AA seq 503 aa
MAEALDSSRTASNALERITDRTLVKTQSYVDGAWVGATDGATFPVYDPATNAHLADVANL
GHAETLRAIDAANAAWPAWRELTGKERAGLMRRWFELLIANADDLAALMTAEQGKPLAEA
KGEIVYGASFIEWFAEEAKRVSGDVMASTWRDKRMVVLKQPVGVCASITPWNFPLAMITR
KVAPAMAAGCTIVIKPAEQTPLSALAMAELAHRAGIPKGVVNVVTGDADRSIAIGKALCE
SPIVRHLSFTGSTPVGRILMQQCSPTVKKVALELGGHAPFIVFDDADIDAAVEGAVQSKY
RNAGQTCVCTNRFYVHASVYDTFVEKLSAKVRGIKVGNGFESGVVQGPLIDDQAVEKVQR
HIDDATQKGARLTAGGKLMQGFGSQRFVEPTVLADATPDMLIAREETFGPVSAIFKFQDE
AEVVRLANDTEFGLASYFFSRDIGRIWRVAEQLEYGMVGINTGLISNEVAPFGGIKQSGL
GREGSVYGIDEYLELKYLCMGGI
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggccgaagcactcgactcatcccgcacagcctccaacgcgctggagcgcatcacggac
cgcaccctcgtcaagacgcagtcctatgttgacggcgcctgggtaggcgcgacagacggc
gcgacgtttcccgtctacgaccctgccaccaacgcacacctggccgacgtcgccaatctc
ggccacgcagaaacgctgcgcgcgatcgacgcggcaaatgcggcgtggcccgcgtggcgc
gagctgaccggcaaggagcgcgctggcctgatgcgccgctggttcgagctgctgatcgcc
aacgccgacgacctcgccgcgctgatgacggctgaacaaggcaagccgctggccgaagcc
aagggcgaaatcgtctacggcgcgtcgttcatcgaatggtttgccgaagaggccaagcgc
gtctccggcgacgtgatggccagcacctggcgcgacaagcgcatggtcgtgttgaagcag
ccggtcggtgtgtgcgcatccatcacgccgtggaacttcccgctggcgatgatcacccgc
aaagtcgcgccggccatggcggcaggctgcaccatcgtcatcaagccggcagaacagacg
ccgctttccgcgctggcgatggccgaactggcgcaccgcgcaggcattcccaagggcgtg
gtgaacgtggtgacgggcgatgcagaccgctcgatcgccatcggcaaagccctgtgcgaa
tcgccgatcgtgcggcatctgtcgttcacgggctcgaccccggtcggtcgcatcctgatg
cagcaatgttcgccgacggtgaaaaaggtggcgttggaactgggtggccatgcgccgttc
atcgtgtttgacgacgccgacatcgatgccgccgtggaaggcgcagtgcagtcgaaatac
cgcaacgccggccagacctgcgtgtgtacgaaccgtttctatgtccatgcctcggtgtac
gacacgtttgtcgaaaagctctcggccaaggtgcgcggcatcaaggtcggcaacggtttc
gaatcgggcgtagtgcaaggcccgctgatcgacgaccaggccgtggaaaaagtgcagcgc
cacatcgacgacgcgacgcagaaaggcgcacgcctgaccgccggcggcaagctgatgcag
ggcttcggctcgcagcgttttgtcgagcccaccgtgctggcggacgccacgcccgacatg
ctgattgcgcgcgaagagaccttcggcccggtctccgccatcttcaaattccaggacgaa
gcggaagtcgtgcgcctggccaacgacaccgaattcggcttggcttcgtacttcttcagc
cgcgacatcggccgcatctggcgcgtggccgagcagctcgaatacggcatggttggcatc
aacacggggctgatctcgaacgaggtcgcgccgtttggcggcatcaagcagtcgggcctc
ggccgtgaaggttcggtctacggcatcgacgagtatctcgaactcaagtatctgtgcatg
ggcggcatctga

DBGET integrated database retrieval system