KEGG   Ralstonia pickettii 12D: Rpic12D_0701
Entry
Rpic12D_0701      CDS       T00925                                 

Definition
(GenBank) UbiD family decarboxylase
  KO
K03182  4-hydroxy-3-polyprenylbenzoate decarboxylase [EC:4.1.1.98]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00130  Ubiquinone and other terpenoid-quinone biosynthesis
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Rpic12D_0701
Enzymes [BR:rpf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.98  4-hydroxy-3-polyprenylbenzoate decarboxylase
     Rpic12D_0701
SSDB
Motif
Pfam: UbiD
Other DBs
NCBI-ProteinID: ACS62002
UniProt: C6BE42
Position
1:complement(733859..735370)
AA seq 503 aa
MQYRDLRDFLAQLERAGELRRIHRPVSPRLEMTEVCDRLLRAEGPAVVFEQPVDAAQKYD
MPVLANLFGTTRRVALGMGAESLDELRDVGRLLSALKEPEPPRGLREAGKLWTMAKAVWD
MAPRKVSSPACQEIVWEGNDVDLSRIPVQTCWPGDAAPLVTWGLVITRGPHKKRQNLGIY
RQQVISRNQLIMRWLAHRGGALDFREHAIANPGQPFPIAVALGADPATILGAVTPVPDTL
SEYQFAGLLRGSRTELATCLTPSLVQAQLQVPAGAEIILEGHIQPDPTHPSGYQHALEGP
FGDHTGYYNEQDWFPVFTVERITMRRDPIYHSTYTGKPPDEPAVLGVALNEVFVPLLQKQ
FPEIADFYLPPEGCSYRMALVSMKKQYAGHAKRVMFGVWSFLRQFMYTKFIVVVDDDVNL
RDWKEVIWAITTRVDPARDTVMVENTPIDYLDFASPVSGLGSKMGIDATNKWPGETTREW
GQPIVMDAAVKARVDAMWDTLFQ
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgcaatacagagacttacgtgactttctcgcccagctcgagcgcgcgggcgaactgcgc
cgcatacaccggccggtgtcgccgcgcctggaaatgaccgaagtctgtgaccgtctgctg
cgcgccgaaggcccagcggtcgtctttgagcagccggtggacgccgcacagaagtacgac
atgccggtgctggcgaacctgtttggcaccacgcgtcgcgtggcgctcggcatgggcgcg
gagtcgctcgatgaactgcgggacgtcggtcgcctgctctcggccttgaaagagcccgaa
ccgccgcgcggcctgcgtgaagccggcaagctgtggacgatggccaaggccgtatgggat
atggcgccgcgcaaggtgtcgtcgccggcatgccaggagatcgtgtgggaagggaatgac
gtcgacctctcgcgcatccccgtacagacgtgctggcctggcgatgcggcgccgcttgtc
acctgggggctggtcatcacgcgcgggccgcacaagaagcggcagaacctggggatctac
cggcagcaggtcatcagtcgcaaccagctcatcatgcgttggctggcgcaccgaggcggc
gcgctggatttccgcgagcacgccatcgccaatccgggtcagccgtttcccattgcggtg
gcactgggcgccgacccggccaccattcttggcgcggtgacgccggtgccggacacgttg
tcggagtaccagtttgcggggctgctacgcggcagccggaccgaacttgcgacatgcctg
acgccgtccttggtgcaggcgcaactgcaagtgccggctggcgccgaaatcatcctcgaa
ggccacatccagccggacccgacgcacccgagtggctatcagcacgcgctcgaaggcccc
ttcggcgatcacaccggctattacaacgagcaggactggttccccgtgttcacggtcgag
cgcatcacgatgcgccgcgacccgatctatcactccacatatacaggcaagccgcccgat
gagccggccgtgctcggcgtggcgctcaatgaagtgttcgtgccgctgctgcagaagcag
tttccggagattgccgatttctatctgccgcccgagggctgcagctatcgcatggcgctg
gtcagcatgaagaagcaatacgccggccacgccaagcgcgtgatgtttggcgtgtggagt
ttcttgcggcagttcatgtatacgaagttcatcgtggtggtggacgacgatgtgaacctg
cgcgactggaaggaagtgatctgggcgatcaccacccgcgtcgatccggcgcgcgatacg
gtgatggtggaaaacacgccgatcgactacctcgatttcgcctccccggtgtcgggcctg
ggctccaaaatgggcatcgatgccaccaacaaatggcccggcgagaccacgcgcgaatgg
ggccagcccatcgtcatggatgccgctgtcaaagcccgcgtcgacgccatgtgggacacg
ctcttccaataa

DBGET integrated database retrieval system