KEGG   Ralstonia pickettii 12D: Rpic12D_0703
Entry
Rpic12D_0703      CDS       T00925                                 

Definition
(GenBank) aminotransferase class I and II
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 PALP
Other DBs
NCBI-ProteinID: ACS62004
UniProt: C6BE44
Position
1:complement(737170..738354)
AA seq 394 aa
MDAHRLQTAARLANIRAFHVMELAKQARELELAGRSIIHMGIGEPDFTAAEPVVQAAADA
MRRGVTQYTGALGIRPLRQAIARYYHTVYGLEIAPERIIVTAGASAALLLACAVLVEIGG
EVLMPDPSYPCNRHFVAAFNGEAKLVPSGPDERFQLTAAQVDAHWGDRTQGVLLASPSNP
TGTSILPDELQRIVQTVRARGGFSIVDEIYQGLSYDQAPVSALSFGDDVVTINSFSKYFN
MTGWRLGWLVAPAELVPEFEKVAQNLFICASAVAQYAALACFEPEALAIYEERKAEFRRR
RDFIVPALESLGFKVPVKPDGAFYVYADCRGVNHPRADDADALTQSMLHDAGVVLVPGLD
FGPHTARHYIRLSYATSMAHLEEAVARLGKLFGR
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggacgcccaccgcctgcagacagccgcccggctggccaatatccgcgcctttcacgtg
atggagctggccaagcaggcccgcgagctggaactggctggacgcagcatcattcacatg
ggcatcggcgagccggacttcaccgccgccgagcccgtcgtgcaagccgcggcggacgcc
atgcggcgcggcgtcacgcagtacaccggggccttgggcattcgcccgctgcgccaggct
atcgcccgctactatcacaccgtctacggcctcgagattgcacccgagcgcatcattgtg
acggcgggcgcgtcggcggcattgctgctggcgtgtgcggtgctggtggagatcggcggc
gaagtcctgatgcccgatccgagctatccgtgcaaccgtcacttcgtggctgccttcaat
ggcgaggcaaagctggtgccgtcggggccggacgaacgcttccagttgacggctgcgcag
gtcgacgctcactggggcgaccgcacgcagggcgtgctgctggcctctccttccaatccg
acgggcacgtcgatcctgccggatgagctgcagcgtattgtgcagacggtacgcgcgcga
ggcggattttcgatcgtcgacgagatttaccaaggcctttcgtacgaccaagcccccgtc
tcggcactgtcgttcggcgacgatgtcgtcacgatcaacagcttctccaagtatttcaac
atgaccggctggcgactcggctggctggtggcgcccgccgaactggtgcccgagttcgaa
aaggtcgcgcagaacctgttcatctgcgcgtcggcggtggcgcagtacgcggcgcttgcc
tgcttcgagccggaagcgttggcgatttacgaagagcgcaaggccgaattccgccgccgc
cgggatttcattgtgccggccctggaatcgctcggcttcaaggtaccggtcaagccggac
ggagcgttctatgtttacgccgattgccgaggcgtgaaccatccgcgtgccgacgatgcc
gatgccctcacccagtcgatgctgcacgacgcgggcgtggtgctcgtgccgggactcgat
tttggaccgcatacggcgcggcactacatccggctgtcctacgccacgtcgatggcacat
ctggaagaagcggtcgcacggctcggcaagctattcggtcgataa

DBGET integrated database retrieval system