KEGG   Ralstonia pickettii 12D: Rpic12D_0704
Entry
Rpic12D_0704      CDS       T00925                                 

Definition
(GenBank) NusB antitermination factor
  KO
K03625  transcription antitermination protein NusB
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rpf03021]
    Rpic12D_0704
   03009 Ribosome biogenesis [BR:rpf03009]
    Rpic12D_0704
Transcription machinery [BR:rpf03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     Rpic12D_0704
Ribosome biogenesis [BR:rpf03009]
 Prokaryotic type
  rRNA transcription factors
   Rpic12D_0704
SSDB
Motif
Pfam: NusB
Other DBs
NCBI-ProteinID: ACS62005
UniProt: C6BE45
Position
1:complement(738398..738865)
AA seq 155 aa
MTQDNSQAKTKAPAKSARRRARELALQGLYQWLLNRNDPGVVEAHLQDAQGFNKADRAHF
DALLHGAIREETTLTEAFTPYLDRPVAELSPVERAALLVGAYELVHCVDIPYKVVINEAV
ELTKTFGGVEGYKYVNGVLDKLAAQVRAVEVAARR
NT seq 468 nt   +upstreamnt  +downstreamnt
atgacgcaagacaattcccaagccaagaccaaggcccccgccaagagcgcgcgccgccgt
gcgcgcgaactggcattgcagggtctgtatcaatggctgctcaatcgcaacgaccccggt
gtggtcgaggcgcatctgcaagacgcacaaggtttcaacaaggccgaccgtgcgcacttc
gacgcgctgctgcacggtgcgatccgcgaagaaaccacgctgaccgaggcgttcacgccg
tacctggatcgcccggttgccgagctgtcgcccgtcgagcgtgccgccctgctggtcggc
gcgtacgagttggtgcactgcgtggacatcccgtacaaggtcgtgatcaacgaggccgtt
gaactgaccaagaccttcggcggtgtggaaggctacaagtacgtcaacggcgtgctggac
aaactggccgcccaggtccgcgctgtcgaggtcgctgcccgccggtaa

DBGET integrated database retrieval system