KEGG   Ralstonia pickettii 12D: Rpic12D_0705
Entry
Rpic12D_0705      CDS       T00925                                 

Definition
(GenBank) 6,7-dimethyl-8-ribityllumazine synthase
  KO
K00794  6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00740  Riboflavin metabolism
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Rpic12D_0705
Enzymes [BR:rpf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.78  6,7-dimethyl-8-ribityllumazine synthase
     Rpic12D_0705
SSDB
Motif
Pfam: DMRL_synthase
Other DBs
NCBI-ProteinID: ACS62006
UniProt: C6BE46
Position
1:complement(738893..739393)
AA seq 166 aa
MDHGFYPTNLNGEGLRIGIVQARFNEPVCEALREACVAELEQLGVAGEDVLLVTVPGALE
VPLALQKMAESGQFDALIALGAVIRGETYHFELVSNESGAGITRVGLDFNIAIANGILTT
DTDAQAHARTREKGRDCARTAVEMANLTNDLDGLQDHGQDDDGENE
NT seq 501 nt   +upstreamnt  +downstreamnt
atggaccacggcttctacccgaccaatctcaacggcgaaggcctgcgcatcggcatcgtc
caggcgcgtttcaacgagcccgtgtgcgaagcgctgcgcgaagcgtgcgtcgctgaactc
gaacaactcggtgtggccggcgaagacgtgctgctggtcaccgtgccgggtgcgctggaa
gtcccgctggccctgcagaagatggccgaatcgggccagttcgacgcgctgatcgcgctg
ggtgcagtcatccgcggcgagacgtaccacttcgagctggtgtccaacgaatcgggcgcc
ggcatcacgcgcgtgggcctggacttcaacatcgccatcgccaacggcatcctgaccacc
gacaccgacgcacaggcccacgcccgcacccgcgaaaaaggtcgcgactgcgcccgcacc
gctgttgagatggccaacctgaccaatgacctcgatggtctgcaggatcacggtcaggac
gacgacggcgagaatgaataa

DBGET integrated database retrieval system