KEGG   Ralstonia pickettii 12D: Rpic12D_0709
Entry
Rpic12D_0709      CDS       T00925                                 

Definition
(GenBank) putative type 4 fimbrial pilin related transmembrane protein
  KO
K08084  type IV fimbrial biogenesis protein FimT
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_0709
Secretion system [BR:rpf02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Rpic12D_0709
SSDB
Motif
Pfam: GspH N_methyl
Other DBs
NCBI-ProteinID: ACS62010
UniProt: C6BE50
Position
1:complement(742538..743110)
AA seq 190 aa
MNASRLRAGFTLTELVVVLSVISILAVFAAPAALNWWQRETVVVLADRFVSAISLAQTMS
RDQRAWVHLGPSNAGQGWSSGWAMYMTPSPQTQATPLEPGTQDILMRVSPPVMPPVEFAF
TASQQDVDTLSFAPVGYSRQRNGSQLYGTLTIRSGAHERRVRISSAGRARICDPAKDTKT
CGTGASANND
NT seq 573 nt   +upstreamnt  +downstreamnt
atgaacgcgtctcgtctgcgggccggcttcacgctgactgagctcgtcgtcgtcctgagc
gtgatatcgatccttgcggtgttcgccgcgcccgcagcgttgaattggtggcaacgcgag
accgtcgtcgttctggccgaccgctttgtcagcgcgatctcgctggcgcagaccatgtcg
cgcgatcagcgtgcgtgggtccacctcggcccgtccaacgctgggcaaggctggtcgtcg
ggatgggcgatgtatatgacgccctcgccgcaaacgcaggcgacgccccttgaacccggc
acccaagatatcttgatgcgcgtgtcgccgcctgtgatgccgcccgtcgaatttgcgttc
acggcgtcacagcaggatgtcgacaccctctcttttgcacctgtgggatactcgcgacag
cgcaacggcagccagctctacggcacgctgacaatccgatctggagcacatgagcggcgg
gtccgtatcagttccgcaggccgcgcccgcatctgcgatccggccaaggacaccaaaacg
tgcggcactggcgcctcggctaacaacgattaa

DBGET integrated database retrieval system