KEGG   Ralstonia pickettii 12D: Rpic12D_0711
Entry
Rpic12D_0711      CDS       T00925                                 

Definition
(GenBank) Tfp pilus assembly protein PilX-like protein
Organism
rpf  Ralstonia pickettii 12D
SSDB
Motif
Pfam: PilX SPO11_like
Other DBs
NCBI-ProteinID: ACS62012
UniProt: C6BE52
Position
1:complement(743508..744299)
AA seq 263 aa
MLSVSAKARGFSMMVVMPAVVLLGLLTTATFHLVLDQRHRTSLTADRALAKYGAEMALNA
AECELSVATETPTNLECMAALPRERIAALEPGSRRGFLMGACGSDVSLGLCQPQPDQSLW
MLARLLDATTLAVEIDARLPGTLRTAGRTARYVIEPIPDRWHGQTRHSDDTPPLWLYRIT
AAGFGADPAVSVVLQTVFRPRVPRHTSTPQTTTEAALPTIRPSGTVTQRVYTTSDQHDAT
APHSQTFMLGRLNWRELIEEGLR
NT seq 792 nt   +upstreamnt  +downstreamnt
atgttgagcgttagcgccaaagcgcgtggtttctcgatgatggtcgtgatgcctgcggtg
gtgttgctcggcctactgaccacggcgaccttccatctggtgttggatcaacgacaccgc
acgtctctcacggccgatcgtgccttggccaaatacggcgccgaaatggcgctgaatgcg
gcggagtgcgaactgtccgtcgccaccgaaacgcccacgaacctcgaatgtatggcggcc
ttgccccgggaacgtatcgccgccctggaaccgggttcgcgacgaggcttcctcatggga
gcgtgcggcagcgacgtctcgctcgggctatgtcagccgcaacccgaccagtcgctctgg
atgttggcgcgactgctcgatgcaaccaccctcgccgtagagatcgacgcacgcctccca
ggcaccctgcgcactgctggccgcactgcgcggtacgtcattgagccgattcccgatcga
tggcacggccaaactcggcatagcgatgacacgccaccgctttggttgtatcgcatcacg
gcagcaggatttggcgccgaccccgcggtcagtgtcgtgctgcaaacagtcttccgcccc
cgagtgccgcgccatacatccacgcctcagaccaccaccgaagctgcactgcccaccatt
cgacccagtggcacggtgacacaacgcgtctacaccacaagcgaccagcacgacgcaacc
gccccccattcgcaaaccttcatgctcggccgcctgaactggcgtgagctgatcgaggag
ggcctacgatga

DBGET integrated database retrieval system