KEGG   Ralstonia pickettii 12D: Rpic12D_0712
Entry
Rpic12D_0712      CDS       T00925                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02672  type IV pilus assembly protein PilW
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_0712
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_0712
Secretion system [BR:rpf02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Rpic12D_0712
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_0712
SSDB
Motif
Pfam: PilW N_methyl
Other DBs
NCBI-ProteinID: ACS62013
UniProt: C6BE53
Position
1:complement(744293..745225)
AA seq 310 aa
MCRLSHARRGATLAELLIGTLVGLIVLGIALQLTLLARASYQRVADDALIESRGTQALEL
LTMALQHAGWATDTPAASPERRWPDAKATLSIQGADSCTPPETEVLGCNGSGIRNSDAVL
VRFAGRSMHANPQRADDSIIDCSGYGVAEPVQNGGDDQRAGYMLLYLARSTDQEPQLMCR
SRRHQAGQTVGGRWTSNSMVRGVETMQLLYVVRSPGGTSSTTLSARSLTTEQWRQVQAVH
IALVVRGEYNTPRSANKATSTLALFPDLKRVEGADAQDLHFTPTEPQRRRAVFTATVRLR
NPLACDVDVC
NT seq 933 nt   +upstreamnt  +downstreamnt
atgtgccggctctctcatgctcggcggggcgcgacgcttgcggagttgctgatcggcacg
ctggtcgggctgatcgtgcttggcatcgcgctgcaactgacactcctggcccgtgcaagc
tatcagcgcgttgccgacgatgccctgatcgaaagccgcggcacgcaagcgctggaattg
ctgacaatggcactgcagcatgcagggtgggcaaccgatacgccagcagcatcgccagag
cgccgatggccagacgcgaaggcgacgctatcgattcaaggtgcggacagttgcacccct
cccgaaacggaagtccttggctgcaacggcagtggcatccgaaacagcgatgccgtgctg
gtccgctttgctggccgcagcatgcatgccaacccgcagcgagctgacgacagcatcatc
gattgctccggctacggggtcgctgagccggttcaaaacggcggcgacgaccagcgcgcg
ggatacatgctgctttatctcgcccgatcgacggatcaagaaccgcagctcatgtgccgc
tcgcgaaggcatcaagccggtcagactgtggggggccgttggacatctaatagcatggtc
cgcggcgtcgaaacaatgcagcttctgtatgtggttcgctcccccggcggcacctcgagc
acgacactgtccgcgcggtcgctcactaccgagcaatggcgccaggttcaagccgtgcac
atcgcgctggtcgttcgcggcgaatacaacacgcccaggtcagccaacaaggccacgtcc
acactcgcgctatttcccgacctcaagcgagttgaaggcgccgacgcacaggacttgcac
ttcacgccaaccgaaccccaacgccgtcgtgccgttttcacggcaacggtacgcttgcgc
aatccactcgcctgcgatgtggacgtatgttga

DBGET integrated database retrieval system