KEGG   Ralstonia pickettii 12D: Rpic12D_0714
Entry
Rpic12D_0714      CDS       T00925                                 

Definition
(GenBank) type IV pilus modification protein PilV
  KO
K02671  type IV pilus assembly protein PilV
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_0714
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_0714
Secretion system [BR:rpf02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Rpic12D_0714
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_0714
SSDB
Motif
Pfam: N_methyl 4HB_MCP_1
Other DBs
NCBI-ProteinID: ACS62015
UniProt: C6BE55
Position
1:746511..747014
AA seq 167 aa
MNARPLNSTARGYALLEALIALLVISVGLIGFSRLQLIGMSSSNISTQRSKAVYLAFEIS
DRMRANLAGYSAGAYSSLSGAASNPNCVSNSAGCSAAQIAQNDYYEWSNELSTQLPQGAG
VVCLTSKISPTATPTAPGCDGGGNVYAVMVWWTENGQQQMLSQSFKP
NT seq 504 nt   +upstreamnt  +downstreamnt
atgaatgctcgccccctgaactccactgcacgaggctacgcgctgttggaagcgctgatt
gcgcttttggtcatttctgtcggcctaattgggttctctcgcttgcaattgatcgggatg
tccagttcgaacatttccacgcaacgaagcaaagccgtttacttggcgtttgagataagc
gacagaatgcgcgctaaccttgcgggctattctgctggcgcctatagcagcctgtcgggt
gccgctagcaatcccaattgtgtgtcgaattcagccggctgctcggcagcgcaaattgct
cagaacgactactacgagtggtcgaacgagcttagtacgcagcttccgcaaggtgctggt
gtggtttgcttgaccagcaaaatatcgccgactgcgacgcccaccgcgcctggctgtgac
ggcggcggaaacgtgtacgccgttatggtctggtggaccgagaacggccagcaacagatg
ctctcgcagagcttcaagccatga

DBGET integrated database retrieval system