KEGG   Ralstonia pickettii 12D: Rpic12D_0715
Entry
Rpic12D_0715      CDS       T00925                                 

Definition
(GenBank) type IV pilus assembly protein PilW
  KO
K02672  type IV pilus assembly protein PilW
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_0715
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_0715
Secretion system [BR:rpf02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Rpic12D_0715
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_0715
SSDB
Motif
Pfam: PilW N_methyl
Other DBs
NCBI-ProteinID: ACS62016
UniProt: C6BE56
Position
1:747011..748045
AA seq 344 aa
MMNRRQTGLSLVELMVGLTLGLLLVGIAVSIYLSGRQTSRVVDTVGRLEESARFAVEAIE
QDIRMTGFRGCNGMANSPVNTLNSPGSFNNRFDQTLFGYHGSGSTWTPALDTSISSLPQP
PIAGTDVIAIKRTYDNGAALTAQMAGTTGAVTVEASAPFAQGDYILVADCDAQAVFQATQ
VTSSPTTGSLSHAAVAVPTPGNASADLTHVFNTDASAYRVVTKTYFVAKSARNKAVNSLW
SYSVPDYTGAGQPQELVEGVDNLVLLYGEDTDSDQAANRYVTADNVGNWNNVVSVRVQLL
MASVQNGVSPISQTYNFNGASATSADRRIRSVFTSVITLRNRVM
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgatgaatcgccgacaaaccggcctctcactagttgaactcatggtcggactgaccctg
ggtttgctgctcgtgggcattgccgtttcgatctatctctcgggtcgtcaaacatcgcgc
gtggttgatacggtggggcgcttggaggaaagcgcccgctttgcggttgaggcgatcgag
caggacatccgcatgaccggttttcgcggttgtaacggcatggccaactcgccggtcaat
accctgaactcgccgggctcctttaataatcgatttgatcagacgctttttggttaccac
ggtagtggatcaacgtggacgcctgcgctcgatacgagcatcagcagccttccgcaacct
ccgattgcggggacagacgtcattgccatcaagcgcacctacgacaatggcgctgcatta
actgcgcagatggcgggaacaactggtgcggtgacggtggaggcaagcgcgccgtttgct
cagggtgactacatcctcgtcgccgactgcgatgctcaagcggtctttcaggcgacgcag
gtcacgagcagtccaacgactggttcgctgtcgcacgcagccgttgctgtgccaacgcct
ggcaatgccagtgcggatctcacgcatgtcttcaacacggatgcttcggcgtaccgtgtc
gtgaccaaaacctattttgttgccaagagtgccaggaacaaagcggtgaactccttgtgg
tcttacagcgtgcctgactacacgggtgcaggtcagccccaggaactggttgagggtgtt
gataacttggttcttctctatggggaagacaccgacagcgaccaggctgcgaaccgctac
gtcacagccgacaacgttggtaactggaacaacgtcgtgagcgtgcgagtgcaactcttg
atggcatcggttcagaacggcgtatcgcctatttcgcagacctacaactttaatggtgcc
tcggcgacatctgccgacagacgcatacgctcggtcttcacgagcgtcattacgctgcgc
aaccgggtgatgtga

DBGET integrated database retrieval system