KEGG   Ralstonia pickettii 12D: Rpic12D_0716
Entry
Rpic12D_0716      CDS       T00925                                 

Definition
(GenBank) Tfp pilus assembly protein PilX
  KO
K02673  type IV pilus assembly protein PilX
Organism
rpf  Ralstonia pickettii 12D
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpf02044]
    Rpic12D_0716
   02035 Bacterial motility proteins [BR:rpf02035]
    Rpic12D_0716
Secretion system [BR:rpf02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Rpic12D_0716
Bacterial motility proteins [BR:rpf02035]
 Pilus system
  Pilus assembly proteins
   Rpic12D_0716
SSDB
Motif
Pfam: PilX PilX_N
Other DBs
NCBI-ProteinID: ACS62017
UniProt: C6BE57
Position
1:748045..748611
AA seq 188 aa
MLVNLIWRRSAQRGVALPVALIFLVLLTLLGLALVNGSVMQEMMFGNSKDTKLAFQAAET
ALRDAELDVAQNITATTAFVQACTSGLCTPPSSWSTPRSASVSTLIDWTNSANTRTYGAY
TGAAALPNVASQPLYVIEKLSGLSVPAGESIGIGVKPPAGGTAYRITVYATGGRPETHVV
LESIYVKR
NT seq 567 nt   +upstreamnt  +downstreamnt
atgctagtgaacttgatttggcgacgtagtgcacaaagaggcgttgccctgcctgtcgcg
ttgatcttcttagtgctccttacgcttctggggttggcgctcgtcaatggctctgtgatg
caggaaatgatgttcggtaacagcaaggacaccaagctggcgtttcaagcagcggaaacg
gcccttcgcgatgctgaattggacgttgcccagaacatcaccgcgacaacggcgtttgta
caggcgtgcacgagtggcttgtgcaccccgccatcttcctggtcaacgccaaggtcggcg
tcggtctctacgctgattgattggaccaacagcgcgaatacgcgtacctacggtgcttat
acgggagcagctgcgttgcccaacgttgcttctcagccgctgtacgtcattgaaaaactc
tccggattgtctgtgccagcgggcgagagtattgggattggcgtgaagccccctgcggga
ggcacggcttatcggatcaccgtctacgcgaccggtgggcgcccagaaacccacgttgtg
ctcgaatccatttacgtgaagcgctga

DBGET integrated database retrieval system